SecReT6
Protein ID: 71907807
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2185
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2359672..2360769 [+]
ProductImpA, N-terminal
NoteTssA
UniProt IDQ47E07
KEGG IDdar:Daro_2185
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-25, Aligned region: 54..115
Protein Sequence: 365 a.a.     [Download]
>gi|71907807|ref|YP_285394.1| ImpA, N-terminal [Dechloromonas aromatica RCB]
MDFEQLTQALPSNHGPCGDDLVFSTEFDEIQEARRFDDPSLSQGEWVTEVKEADWASVVRICEGILAKKS
KDLRVAAWLTEACCKLEGLGGLDNGYTLLGRLCETYWNDIHPQPEDGDIEQRVGVLDWLVNQTARLIRET
PLTHSDKGRFSLINHESARATAKNIERNPGMADELSRTAHVRLETFEAALKDTPKPYFVDGMRNAELLKD
SVKSLQTVLDAKMGEYSPAFSPSFEALDDVYRFFQRHAGDAGTKPLETQDKASDGAGNKALGAIERVEPS
IGGEIGEVACGPIRSRDQAIRQLQEIGAFFRRTEPHSPVAYLAEKAAKWGTMPLHEWLRTVVKDDSALLR
MEELLGVDPNTGESN
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2359672-2360769 Dechloromonas aromatica RCB, complete genome
ATGGATTTTGAACAGCTAACCCAAGCGCTGCCCTCCAACCACGGCCCGTGCGGTGACGATCTGGTCTTTT
CTACCGAATTCGACGAAATTCAGGAAGCCAGGCGCTTTGATGACCCTTCTCTGTCTCAGGGTGAATGGGT
TACTGAGGTCAAGGAGGCTGACTGGGCAAGCGTGGTGCGCATCTGCGAAGGCATCCTGGCCAAGAAGTCC
AAAGATCTGCGCGTTGCCGCCTGGTTGACTGAAGCTTGCTGCAAGCTCGAAGGCCTTGGTGGCCTGGACA
ACGGCTATACGCTACTTGGGCGGTTGTGCGAAACCTACTGGAATGACATCCACCCGCAACCGGAAGATGG
TGATATTGAACAACGGGTCGGCGTGCTTGATTGGCTGGTCAATCAGACGGCTCGCCTGATTCGTGAAACG
CCGCTAACGCATTCCGACAAGGGCAGGTTTTCATTGATCAACCACGAGTCAGCCCGTGCTACGGCCAAAA
ATATTGAACGCAACCCGGGCATGGCCGACGAACTTAGCCGCACCGCTCACGTCAGGTTGGAAACCTTCGA
AGCAGCACTGAAAGATACACCCAAACCTTATTTTGTCGACGGCATGCGCAATGCCGAGCTCCTGAAGGAT
TCTGTCAAATCCCTGCAAACAGTGCTCGACGCAAAGATGGGGGAATATTCACCAGCCTTCAGTCCAAGCT
TTGAAGCACTTGACGACGTTTATCGCTTTTTCCAGCGCCATGCTGGTGATGCAGGAACAAAACCATTGGA
AACACAGGACAAAGCAAGTGATGGAGCGGGAAACAAGGCTCTTGGCGCCATCGAACGGGTCGAGCCAAGC
ATTGGCGGAGAAATCGGCGAGGTAGCCTGCGGGCCAATTCGCTCCCGCGACCAGGCCATTCGCCAACTAC
AGGAAATTGGCGCCTTCTTCCGGCGCACGGAACCGCACAGCCCGGTGGCCTATCTGGCGGAAAAAGCGGC
CAAATGGGGAACGATGCCACTCCACGAATGGCTACGCACAGTGGTCAAGGACGACAGCGCCCTGCTGCGC
ATGGAAGAGTTGCTGGGCGTCGATCCCAACACCGGGGAATCAAACTAA