SecReT6
Protein ID: 71907808
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2186
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2360816..2361601 [-]
ProductOmpA/MotB
NoteTagL
UniProt IDQ47E06, Q47E06
KEGG IDdar:Daro_2186
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.40E-20, Aligned region: 113..113
OmpA [PF00691], Evalue: 1.40E-20, Aligned region: 158..252
BON [PF04972], Evalue: 1.90E-05, Aligned region: 30..68
BON [PF04972], Evalue: 1.90E-05, Aligned region: 97..119
Protein Sequence: 261 a.a.     [Download]
>gi|71907808|ref|YP_285395.1| OmpA/MotB [Dechloromonas aromatica RCB]
MNMKTPLIVAALCLAFQGAAFAQSKSPEEPGKVIASGTVPDEASRAAILGKLRDLYGAGNVVDRMEVGGV
VPPSNWTENMTKIIGPNLKQVHKGQMQVNGTQIAIKGNVANEALRQQVVSNLATSLNPTYTIDNGLVAAA
GEAQNVLDKTLSNRVVEFEVGAATLTPAGRVILDEMYAAIKQIGTPKVQVIGHTDSSGSRQANIALSLSR
ANSVRSYLIEKGLPADGLTAVGSGPDQPVGSNDSSEGRAKNRRIEFKLAGQ
 
Nucleotide Sequence: 786 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2361601-2360816 Dechloromonas aromatica RCB, complete genome
ATGAATATGAAAACCCCACTAATCGTTGCTGCATTGTGTCTCGCCTTCCAAGGGGCAGCTTTTGCCCAGT
CAAAATCCCCCGAAGAGCCAGGTAAGGTGATTGCATCTGGTACCGTTCCGGATGAGGCATCGCGTGCGGC
GATCCTCGGCAAGCTTCGCGATCTTTATGGCGCGGGTAATGTGGTTGATCGCATGGAAGTTGGCGGGGTC
GTTCCGCCAAGTAACTGGACCGAGAACATGACCAAGATCATCGGTCCCAATCTCAAGCAGGTTCATAAGG
GCCAAATGCAGGTTAACGGTACCCAGATCGCGATCAAGGGCAATGTGGCCAATGAGGCTTTGCGCCAACA
GGTGGTCAGCAATCTGGCCACTTCGCTCAACCCAACCTATACCATCGATAACGGCCTGGTTGCAGCTGCT
GGCGAGGCACAGAACGTGCTGGACAAGACGCTATCCAATCGTGTCGTTGAATTCGAGGTTGGCGCAGCAA
CGCTGACGCCGGCTGGGCGTGTCATTCTTGATGAAATGTATGCCGCTATCAAGCAAATCGGCACCCCCAA
GGTTCAGGTGATCGGCCACACTGATAGTTCGGGAAGCCGACAAGCCAATATCGCACTCAGCTTGTCGCGG
GCTAATTCGGTCCGCTCTTACCTTATTGAAAAAGGTCTTCCGGCAGATGGTTTGACTGCAGTGGGCTCGG
GGCCGGATCAACCGGTGGGTTCGAACGATTCGTCAGAGGGGCGGGCGAAAAACCGACGCATAGAATTCAA
ACTGGCCGGTCAATAA