SecReT6
Protein ID: 73539082
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5259
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2008750..2009184 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ46QH9
KEGG IDreu:Reut_B5259
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-17, Aligned region: 33..116
Protein Sequence: 144 a.a.     [Download]
>gi|73539082|ref|YP_299449.1| unnamed protein product [Ralstonia eutropha JMP134]
MTRGGPGLFEAVTGYFANGVAVDEFDPATQTFLSVQDNIQRILNSRRGGLAHLPDYGLGDLSRIYRHLPA
SAHTLQREIEATLLRYEPRLRAIDITIEETEPGMLLSFTMSCHLHQAGLVRFGTHFTPDGKTRLKLLKAV
QDRH
 
Nucleotide Sequence: 435 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2009184-2008750 Ralstonia eutropha JMP134 chromosome 2, complete sequence
GTGACGCGGGGCGGGCCAGGGCTCTTCGAGGCGGTGACGGGATATTTTGCGAACGGCGTCGCCGTGGACG
AGTTCGATCCGGCCACGCAGACCTTCTTGTCAGTGCAGGACAACATCCAGCGCATCCTCAACAGTCGCCG
GGGCGGGCTGGCACACCTGCCCGACTATGGACTTGGAGACCTGTCGCGGATTTACCGCCACCTGCCAGCT
TCCGCGCACACGCTCCAGCGGGAGATCGAGGCAACGCTGCTGCGCTACGAGCCACGTCTCAGGGCGATCG
ACATCACGATCGAGGAAACGGAGCCCGGCATGCTGCTGAGCTTCACCATGAGCTGCCACCTGCATCAGGC
GGGGCTCGTGCGTTTCGGCACCCATTTCACGCCGGACGGCAAGACGCGGCTCAAGCTGCTGAAGGCCGTA
CAGGACCGGCACTGA