SecReT6
Protein ID: 73539083
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5260
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2009181..2011922 [-]
ProductATPase AAA
NoteTssH
UniProt IDQ46QH8
KEGG IDreu:Reut_B5260
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-42, Aligned region: 255..294
AAA_2 [PF07724], Evalue: 2.10E-42, Aligned region: 638..807
AAA [PF00004], Evalue: 7.80E-22, Aligned region: 257..369
AAA [PF00004], Evalue: 7.80E-22, Aligned region: 643..769
AAA_5 [PF07728], Evalue: 6.00E-15, Aligned region: 257..277
AAA_5 [PF07728], Evalue: 6.00E-15, Aligned region: 331..387
AAA_5 [PF07728], Evalue: 6.00E-15, Aligned region: 642..761
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 134..183
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 234..286
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 302..335
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 514..624
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 611..685
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 708..737
AAA_16 [PF13191], Evalue: 9.40E-14, Aligned region: 796..861
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 813..886
AAA_22 [PF13401], Evalue: 2.00E-10, Aligned region: 256..347
AAA_22 [PF13401], Evalue: 2.00E-10, Aligned region: 640..679
Arch_ATPase [PF01637], Evalue: 2.70E-07, Aligned region: 235..271
Arch_ATPase [PF01637], Evalue: 2.70E-07, Aligned region: 309..409
Arch_ATPase [PF01637], Evalue: 2.70E-07, Aligned region: 635..683
AAA_17 [PF13207], Evalue: 3.30E-07, Aligned region: 257..321
AAA_17 [PF13207], Evalue: 3.30E-07, Aligned region: 641..677
Sigma54_activat [PF00158], Evalue: 9.30E-07, Aligned region: 241..336
Sigma54_activat [PF00158], Evalue: 9.30E-07, Aligned region: 642..759
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 251..315
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 642..660
Zeta_toxin [PF06414], Evalue: 1.90E-06, Aligned region: 254..280
Zeta_toxin [PF06414], Evalue: 1.90E-06, Aligned region: 641..682
NACHT [PF05729], Evalue: 3.60E-06, Aligned region: 257..285
NACHT [PF05729], Evalue: 3.60E-06, Aligned region: 642..663
AAA_14 [PF13173], Evalue: 2.80E-05, Aligned region: 257..355
AAA_14 [PF13173], Evalue: 2.80E-05, Aligned region: 641..732
AAA_18 [PF13238], Evalue: 4.00E-05, Aligned region: 257..277
AAA_18 [PF13238], Evalue: 4.00E-05, Aligned region: 643..672
AAA_25 [PF13481], Evalue: 4.20E-05, Aligned region: 257..295
AAA_25 [PF13481], Evalue: 4.20E-05, Aligned region: 311..347
AAA_25 [PF13481], Evalue: 4.20E-05, Aligned region: 436..514
AAA_25 [PF13481], Evalue: 4.20E-05, Aligned region: 640..666
AAA_33 [PF13671], Evalue: 0.00045, Aligned region: 257..289
AAA_33 [PF13671], Evalue: 0.00045, Aligned region: 459..502
AAA_33 [PF13671], Evalue: 0.00045, Aligned region: 641..660
DUF258 [PF03193], Evalue: 0.00061, Aligned region: 118..173
DUF258 [PF03193], Evalue: 0.00061, Aligned region: 243..278
DUF258 [PF03193], Evalue: 0.00061, Aligned region: 642..659
AAA_29 [PF13555], Evalue: 0.00071, Aligned region: 251..273
AAA_29 [PF13555], Evalue: 0.00071, Aligned region: 640..667
AAA_28 [PF13521], Evalue: 0.00072, Aligned region: 257..332
AAA_28 [PF13521], Evalue: 0.00072, Aligned region: 475..507
AAA_28 [PF13521], Evalue: 0.00072, Aligned region: 642..662
Clp_N [PF02861], Evalue: 0.0012, Aligned region: 43..84
Clp_N [PF02861], Evalue: 0.0012, Aligned region: 126..144
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 258..279
RNA_helicase [PF00910], Evalue: 0.0012, Aligned region: 643..663
AAA_10 [PF12846], Evalue: 0.0023, Aligned region: 256..289
AAA_10 [PF12846], Evalue: 0.0023, Aligned region: 323..345
AAA_10 [PF12846], Evalue: 0.0023, Aligned region: 642..664
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 257..280
SRP54 [PF00448], Evalue: 0.0026, Aligned region: 641..676
RuvB_N [PF05496], Evalue: 0.0026, Aligned region: 255..276
RuvB_N [PF05496], Evalue: 0.0026, Aligned region: 326..337
RuvB_N [PF05496], Evalue: 0.0026, Aligned region: 611..663
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 254..278
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 450..461
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 640..661
MobB [PF03205], Evalue: 0.0051, Aligned region: 258..286
MobB [PF03205], Evalue: 0.0051, Aligned region: 641..664
Mg_chelatase [PF01078], Evalue: 0.0052, Aligned region: 253..274
Mg_chelatase [PF01078], Evalue: 0.0052, Aligned region: 641..663
Mg_chelatase [PF01078], Evalue: 0.0052, Aligned region: 711..733
Protein Sequence: 913 a.a.     [Download]
>gi|73539083|ref|YP_299450.1| unnamed protein product [Ralstonia eutropha JMP134]
MRAAPDTSCRTSLSLLQFAMTSRDYSPFLRRLNAHCAHALADAASLCETRAHRDIEVEHWLVKLLELGEG
DLLAILRRYELDVDGVWNGLLTAIDRLPHDLRGKPGLSARLGQWLEAAWVKASLDSGAHSIRSAHLLAAL
AETPNLLRAPDAWPLLSISATQIERLIPELDKISTEADLPGASPTPANPRMSDSPSQTPTMPPRPLPGQA
DTSALARFTTDITQKARDGRIDPVFGRDTEIRQMIDILARRRKNNPILVGEPGVGKTALVEGLALKIAQA
DVPAVIRDVSVLTLDLGLLQAGAGVKGEFEQRLKNVIEAVQQSSTPILLFIDEAHTLIGAGNNAGGADAA
NLLKPALARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDEGACLMVRGLKERYAQHHGVHIT
DAAVAAAVRLSRRYLTGRQLPDKAVDLLDTAAARVRMSQEATPVAISACEAERAALEVERTALRQDQGAT
GTSDAERLAAIDERLASLDAQHEELERSFAEQKDSAQALLALRGQWQAASDASVRRDLEPSILAAHQVLA
RAGQTSLIHAEVDENVIAQVIADWTGVPVDSQLSNELATLLELESRLGEVVVGQDEALAALGKSLRAARA
GLKCEEAPIGVFLLVGPSGVGKTETARALADLMFGGERSLITINLSEYQEAHTVSQLKGSPPGYVGYGEG
GILTEAVHQRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFMRDGEGRVIDFRNTVILMTSNLGSDEILAAN
QAVAEAGGDITTAILMETIRPQLVDHFQPALLARFQTVVYRPLAAEAMERIVRMKLAKVATRIERRFGVP
LQCEDALVAELVRACLLPDSGARNIDSLLDQQILPVLARELLARMMDTQILAAIRLSFSDEDGIGVEIEE
VSR
 
Nucleotide Sequence: 2742 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2011922-2009181 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGCGTGCGGCACCTGACACCAGTTGCCGCACTTCACTTTCTCTTCTGCAGTTCGCCATGACCAGCCGTG
ACTATTCCCCGTTTCTGCGCCGCCTGAATGCGCACTGCGCCCATGCGCTGGCCGATGCCGCCAGCCTTTG
TGAAACGCGAGCCCACCGGGACATCGAGGTGGAGCACTGGCTGGTCAAGTTGTTGGAACTCGGCGAAGGC
GACCTGCTGGCGATCCTGCGGCGATATGAACTGGACGTGGATGGAGTCTGGAATGGTCTGCTTACCGCCA
TTGACCGGCTGCCACACGACCTGCGCGGCAAGCCGGGATTGTCGGCACGTCTTGGCCAATGGCTGGAAGC
GGCCTGGGTCAAGGCCTCTCTTGATAGCGGGGCGCATTCGATCCGCTCCGCCCACCTCCTGGCCGCGTTG
GCGGAGACTCCCAACCTGCTGCGGGCGCCGGATGCCTGGCCATTGCTGAGTATTTCGGCGACACAGATTG
AACGCCTGATTCCTGAACTGGATAAGATCTCCACCGAAGCTGATCTCCCGGGTGCATCTCCCACGCCGGC
AAATCCGCGGATGTCCGACTCCCCATCGCAGACGCCGACGATGCCACCCCGACCGTTGCCGGGTCAGGCC
GACACCTCTGCGCTGGCACGGTTCACTACCGACATTACGCAGAAGGCGCGCGACGGCAGAATCGACCCCG
TGTTCGGCCGTGACACGGAGATCCGCCAGATGATCGATATTCTCGCGCGTCGCCGTAAGAACAATCCGAT
CCTGGTAGGCGAGCCGGGGGTAGGTAAAACGGCGCTGGTCGAAGGGCTGGCCCTTAAGATCGCGCAAGCA
GATGTCCCGGCAGTCATCCGCGATGTCAGCGTGCTGACGCTGGATCTGGGGCTCCTGCAGGCCGGAGCTG
GCGTCAAGGGAGAGTTCGAACAGCGCCTCAAGAACGTGATAGAGGCCGTGCAGCAGTCGTCCACGCCGAT
CTTGCTCTTCATCGACGAGGCGCACACGCTGATTGGCGCGGGCAACAATGCCGGCGGCGCCGACGCCGCC
AACCTCCTGAAACCCGCGCTTGCACGCGGCGAACTGCGCACGATCGCCGCAACGACCTGGTCGGAATACA
AGCAGTACTTTGAGCGTGACGCGGCGCTTGAGCGCCGGTTCCAGATGGTCAAGGTCGACGAGCCAGACGA
TGAAGGCGCTTGCCTGATGGTGCGGGGACTCAAGGAGCGCTATGCGCAGCACCACGGGGTGCACATCACC
GATGCAGCAGTTGCAGCAGCGGTCAGACTTTCGCGCCGGTATCTCACCGGGCGCCAGTTGCCTGACAAGG
CGGTAGATCTGCTCGACACTGCCGCCGCTCGCGTGCGGATGAGCCAGGAGGCGACACCGGTCGCCATCTC
CGCCTGCGAAGCCGAGCGCGCCGCACTGGAGGTCGAGCGAACCGCCCTGCGACAGGATCAGGGTGCCACC
GGGACCAGCGACGCCGAACGGCTGGCCGCCATCGATGAGCGACTGGCGTCACTGGATGCCCAACACGAAG
AGCTTGAGCGCTCCTTTGCCGAACAGAAGGACTCCGCGCAGGCGCTGCTGGCCTTGCGTGGGCAATGGCA
AGCCGCCTCGGATGCTTCGGTGCGCCGGGATCTGGAGCCGTCGATCCTGGCAGCACACCAGGTGCTCGCG
CGTGCCGGCCAGACGTCCCTGATTCATGCGGAAGTCGATGAGAACGTCATCGCGCAGGTCATCGCCGACT
GGACCGGGGTTCCAGTCGACAGTCAGCTGTCCAATGAACTCGCCACGTTGCTGGAACTGGAATCCCGCTT
GGGTGAGGTGGTGGTGGGTCAGGACGAAGCGCTGGCCGCGCTTGGCAAGAGCCTGCGTGCTGCCAGGGCG
GGGCTCAAGTGCGAGGAAGCACCCATTGGGGTTTTTCTGCTAGTCGGTCCGTCCGGAGTCGGCAAGACAG
AAACTGCGCGAGCATTGGCCGACCTGATGTTTGGCGGAGAGCGATCGCTCATTACCATCAACCTGTCTGA
ATATCAGGAGGCACACACCGTCTCCCAGTTGAAGGGTTCGCCGCCGGGCTATGTTGGCTATGGCGAAGGC
GGCATCCTGACCGAGGCCGTTCACCAGCGTCCCTACAGTGTGGTGTTGCTGGATGAAGTGGAAAAGGCCC
ACCGCGATGTGCTGAACCTGTTCTACCAGGTGTTCGATCGCGGCTTCATGCGCGACGGCGAGGGCCGGGT
CATTGACTTCCGCAACACGGTCATTCTCATGACGTCGAACCTGGGCAGCGATGAAATTCTTGCAGCCAAC
CAGGCCGTTGCCGAAGCTGGCGGCGATATCACCACCGCCATACTGATGGAGACCATCCGGCCCCAGCTGG
TGGACCATTTCCAGCCCGCGTTGCTGGCGCGCTTCCAGACCGTCGTATACCGTCCCCTCGCCGCCGAGGC
CATGGAAAGGATCGTACGCATGAAGCTCGCGAAGGTGGCAACTCGCATCGAGCGCCGCTTCGGCGTGCCA
CTGCAGTGCGAGGACGCGCTGGTGGCCGAGTTGGTCCGTGCCTGCCTGCTCCCCGATTCCGGCGCCCGCA
ACATCGACAGCCTGCTGGATCAGCAGATTCTGCCTGTGCTGGCGCGCGAGTTGCTCGCGCGCATGATGGA
CACGCAAATCCTGGCCGCAATCCGGCTGTCGTTTTCCGACGAAGACGGTATTGGCGTGGAGATTGAAGAG
GTGTCGCGGTGA