SecReT6
Protein ID: 73539085
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5262
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2012449..2014176 [-]
ProductOmpA/MotB protein
NoteTagL
UniProt IDQ46QH6, Q46QH6
KEGG IDreu:Reut_B5262
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.40E-17, Aligned region: 447..543
DUF4381 [PF14316], Evalue: 0.0033, Aligned region: 28..70
DUF4381 [PF14316], Evalue: 0.0033, Aligned region: 377..392
Protein Sequence: 575 a.a.     [Download]
>gi|73539085|ref|YP_299452.1| unnamed protein product [Ralstonia eutropha JMP134]
MFVTGYPYRTLFSWVTALALAWLALSSPWAMTWNLLLAGLVIVLALVAIVVATRRARARRQASRAVLEAI
HVSLDTLPGDLRQNTPIVLTVGDCAPALVFGEPLVRMTDAAIWVRVHEPTRLAYVADALKRWREGQGPDA
VACLVGADQACDPATLSAGLRRWRAAIGEASRAVGYPLPVCVAVYAEEASGPPDDCPWFGISGGSLPSGE
ALCDQLADRLAQYPQAAAPVDRAERMGRAARLDALVRWASGALLPALRDDGRESGRSGRPVRVAAFGVTA
VKGIPAHDSLYARFVTQLTGLATSAREGNRASYPLPDALIRGIAVQPVRRALPSALAHAFAWLALSFCAA
AAASAWQNRALVTRVFGDMAHYRTIGAEHDAARVDALQALKRDRDELEQYQSAGVPPRLGLGFYRGAKLL
APLNTLIAGYQPPAPPPSTIELNSLSLFKSGSAVLNPGSNRVLIGALELIKAHPDKRVLVAGHTDAVGAA
QSNLKLSEARAASVRDWLADAAGLPVTRFAIQGYGDTRPKAPNDTEAGRSANRRVEITLVPDCHDDRRGV
QETLGQSACSFQQKE
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2014176-2012449 Ralstonia eutropha JMP134 chromosome 2, complete sequence
GTGTTCGTGACAGGCTATCCCTATCGCACGCTTTTCAGTTGGGTCACGGCGCTCGCGCTGGCCTGGCTGG
CCCTCAGCTCTCCCTGGGCAATGACCTGGAACCTGCTGCTGGCCGGGCTCGTCATCGTGCTGGCGCTTGT
GGCTATCGTGGTTGCGACGCGGCGTGCCCGTGCCCGCAGACAGGCGTCGCGGGCCGTGCTGGAGGCCATC
CACGTGTCGTTGGACACACTTCCGGGAGACCTTCGCCAAAACACCCCGATCGTGCTGACCGTGGGCGACT
GCGCGCCCGCGCTGGTCTTTGGCGAACCGCTGGTTCGGATGACGGACGCCGCGATCTGGGTGCGCGTGCA
CGAGCCCACCAGGCTGGCCTACGTGGCCGATGCGCTGAAGCGCTGGCGCGAGGGCCAGGGGCCCGATGCC
GTCGCGTGCCTGGTAGGCGCGGACCAGGCATGCGATCCGGCTACGCTCAGCGCTGGACTCAGGCGTTGGC
GTGCTGCTATCGGCGAGGCCAGTCGTGCCGTCGGGTATCCGCTGCCGGTCTGCGTCGCCGTGTACGCGGA
AGAAGCCAGCGGCCCCCCTGATGACTGCCCGTGGTTTGGCATCTCTGGCGGGAGCCTGCCCTCGGGAGAA
GCGCTGTGCGACCAACTGGCCGACCGCCTTGCACAGTATCCGCAGGCGGCAGCGCCAGTTGACCGTGCGG
AGCGCATGGGGCGCGCCGCACGCCTGGATGCGCTCGTCAGGTGGGCGTCCGGCGCATTGTTGCCGGCCTT
GCGGGATGACGGGCGGGAATCAGGACGAAGCGGGCGCCCGGTCCGCGTGGCGGCCTTCGGCGTGACTGCC
GTGAAAGGCATCCCGGCTCATGATTCGCTCTACGCCCGTTTTGTGACGCAGCTCACTGGATTGGCAACGT
CCGCACGGGAAGGGAATAGGGCGTCCTATCCCTTGCCGGATGCATTGATCCGTGGCATTGCTGTGCAGCC
TGTGCGACGCGCCTTGCCGAGCGCGTTAGCACACGCCTTTGCCTGGCTGGCCCTGAGCTTCTGCGCGGCC
GCAGCCGCGTCAGCTTGGCAGAACCGCGCATTGGTGACGCGCGTCTTTGGCGACATGGCCCATTACCGCA
CCATCGGCGCGGAGCACGACGCCGCACGGGTCGACGCGTTGCAGGCGCTCAAGCGCGATCGAGATGAACT
CGAGCAGTACCAGAGCGCCGGCGTGCCGCCACGGCTCGGGCTGGGCTTCTATCGGGGCGCGAAGCTGCTG
GCGCCCCTCAACACCCTGATCGCAGGCTATCAGCCGCCAGCACCACCGCCTTCGACCATCGAACTGAACA
GCCTTTCGCTGTTCAAGAGCGGCAGCGCGGTGCTCAATCCCGGGTCCAACCGCGTCCTGATCGGCGCGCT
GGAGTTGATCAAGGCTCATCCGGACAAGCGCGTACTGGTTGCTGGACACACCGACGCCGTAGGCGCCGCC
CAATCAAACCTCAAGCTGTCCGAGGCACGTGCCGCCTCGGTGCGCGACTGGCTCGCCGATGCGGCTGGTC
TGCCGGTGACGCGCTTCGCAATCCAGGGCTATGGCGACACCCGTCCCAAAGCACCCAACGACACGGAAGC
CGGACGTTCGGCTAACCGCCGTGTCGAGATTACCCTCGTCCCAGATTGCCACGATGACCGTCGCGGCGTT
CAGGAAACTTTGGGCCAGTCGGCCTGTTCATTCCAGCAAAAGGAGTAG