SecReT6
Protein ID: 73539086
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5263
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2014181..2014828 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ46QH5
KEGG IDreu:Reut_B5263
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-44, Aligned region: 11..206
Protein Sequence: 215 a.a.     [Download]
>gi|73539086|ref|YP_299453.1| unnamed protein product [Ralstonia eutropha JMP134]
MTTLTTILPLALRDTALTVTELAGEAKPETFETFRTRCLEHLSRLREEFHAAGHSTAAVEDAAYAQCALL
DEVALRSLQAKERDAWEREPLQVKEFQSHDAGEELIARIERRLAEPQPVLPLLAVFYTVLGLGFQGKFAL
EGTGARERLMRAIDERLERGGVQKNTGPVIVTSGQAREWRGLSPVAWVGIALAGAALVYVALDRWLAVSI
AQLGG
 
Nucleotide Sequence: 648 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2014828-2014181 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGACGACGCTTACTACCATTCTGCCTCTCGCCTTGCGCGACACGGCCTTGACCGTTACGGAACTTGCCG
GGGAAGCCAAGCCGGAGACTTTCGAGACCTTCCGGACCAGGTGCCTTGAGCACTTGAGCCGCCTGCGTGA
AGAGTTCCACGCGGCCGGGCATTCGACGGCCGCGGTCGAAGATGCGGCCTACGCCCAATGCGCGTTGCTG
GACGAGGTGGCCTTGCGCAGTCTGCAGGCCAAGGAGCGCGATGCCTGGGAACGTGAACCCCTGCAGGTCA
AGGAGTTCCAGAGCCATGACGCTGGCGAGGAACTGATTGCCCGCATCGAGCGCCGATTGGCCGAACCCCA
GCCGGTGTTGCCCCTGCTGGCCGTCTTCTACACCGTGCTGGGGCTGGGCTTCCAGGGCAAGTTCGCGCTG
GAGGGCACCGGCGCCCGCGAGCGGCTGATGCGTGCCATCGACGAGCGTCTGGAGCGTGGCGGCGTTCAAA
AGAACACGGGGCCGGTGATCGTTACGAGTGGGCAGGCAAGAGAATGGCGAGGCCTGTCGCCAGTGGCCTG
GGTGGGCATCGCCCTGGCTGGTGCGGCTCTGGTCTATGTTGCGCTGGACCGATGGCTGGCCGTGTCGATC
GCCCAGCTCGGTGGCTGA