SecReT6
Protein ID: 73539087
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5264
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2014825..2016171 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ46QH4
KEGG IDreu:Reut_B5264
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-136, Aligned region: 18..445
Protein Sequence: 448 a.a.     [Download]
>gi|73539087|ref|YP_299454.1| unnamed protein product [Ralstonia eutropha JMP134]
MKITRPLWAQGIFMTPQHFQQQALWERHTDELVARIACPEPWGTVRVALDPQALSIHRLAVSALTVRLPD
GTVIDTETADRPPPARDLADVPASVDAAVVLVGLPLVDAQGGNCMEDGERPARPRRFVREYLSVADLHGE
GKEEISVERHALALLFEFEAHGDYVTCPIARLIRTPQGRFELDPTFVPPCLLVAASDRLTERMKRLSEIL
AAKSASLAVRRRERSDQIADFAVADVALFWLLHSVNSNWPELARLCAAPRQHPERLYGVLSRLAGALLTF
STTETLQAIPAYNHLAPEPVFAELESLIRTLLDTVIPSRVVPVALERTRPTAWVGKILDERLVEGAEYYL
SVQAGLPAHTLLEQLPRLCKAGAPDEVEQIVNSALPGIPLRTMSRLPAAIPVRVENQYFALDSAHPAFQR
MLAARACQFYVPASVPDVSLELFAVLPA
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2016171-2014825 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGAAGATAACGAGACCGCTGTGGGCACAAGGCATTTTCATGACTCCACAGCATTTTCAGCAGCAAGCGC
TGTGGGAGCGCCATACCGACGAGCTGGTTGCGCGCATTGCGTGTCCCGAGCCGTGGGGCACCGTTCGTGT
CGCACTCGACCCGCAAGCGCTATCCATCCACCGACTGGCCGTCAGTGCCTTGACTGTGCGCCTGCCCGAC
GGAACGGTGATTGACACGGAAACCGCGGACCGCCCGCCACCGGCACGCGATCTCGCCGATGTGCCGGCTA
GTGTCGATGCGGCAGTCGTACTGGTCGGCCTGCCACTGGTGGACGCCCAGGGTGGCAACTGCATGGAGGA
CGGCGAGCGTCCCGCCCGGCCGCGACGCTTCGTGCGCGAGTATCTGTCAGTGGCCGATCTGCATGGCGAA
GGCAAGGAAGAGATTAGCGTCGAGCGGCACGCGCTCGCACTGCTCTTCGAATTCGAGGCCCACGGCGACT
ATGTGACCTGCCCGATCGCCCGGCTGATCCGCACGCCGCAAGGGCGATTTGAACTCGACCCGACATTCGT
GCCGCCGTGCTTGCTTGTCGCTGCGAGCGATAGGCTTACCGAGCGGATGAAGCGGCTCTCGGAGATCCTT
GCCGCCAAGAGTGCGAGCCTGGCCGTGCGCCGAAGGGAGCGCTCGGACCAGATTGCCGACTTCGCCGTGG
CAGATGTGGCGCTCTTCTGGCTGCTGCATAGCGTCAACAGCAATTGGCCGGAGCTGGCCCGCCTGTGTGC
AGCACCGCGGCAACATCCGGAACGACTCTATGGCGTGCTGTCCCGCCTGGCCGGGGCGCTGCTGACTTTC
TCGACCACCGAGACATTACAGGCCATTCCCGCTTACAACCACTTGGCGCCAGAACCGGTGTTCGCGGAAC
TGGAATCGCTAATCCGCACGCTGCTCGACACAGTCATCCCGTCGCGGGTGGTTCCCGTTGCGCTGGAACG
AACAAGGCCCACGGCCTGGGTTGGCAAGATCCTCGACGAACGGCTGGTGGAAGGCGCCGAGTACTACTTG
TCCGTCCAGGCAGGCTTGCCCGCTCACACACTGCTCGAACAGCTGCCGCGCCTGTGCAAGGCAGGTGCGC
CAGACGAAGTCGAACAGATCGTCAACTCAGCGCTGCCGGGTATTCCCTTGCGCACCATGTCCCGCCTTCC
CGCAGCGATTCCGGTCCGTGTCGAGAATCAGTACTTCGCACTGGATAGCGCGCATCCGGCCTTCCAGCGC
ATGCTGGCCGCGCGCGCGTGCCAGTTCTATGTTCCGGCCTCCGTGCCGGACGTATCGCTTGAACTTTTTG
CGGTATTGCCGGCATGA