SecReT6
Protein ID: 73539088
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5265
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2016287..2017834 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ46QH3
KEGG IDreu:Reut_B5265
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-178, Aligned region: 91..511
Protein Sequence: 515 a.a.     [Download]
>gi|73539088|ref|YP_299455.1| unnamed protein product [Ralstonia eutropha JMP134]
MAKQEISALAHSEVDTVVLDAPGKTVYESLCEKINLTPVRSARPVESFQSPEALSDSSLDERVAQAMHVF
LKMIQDSSQQVDRLDKSLLDFHIAHLDEQISRQLDAIMHHETFQQIESAWRGLKFLVDRTDFRKNVKIEV
LDASKEALRQDFEDTPEVIQSGLYLHTYIQEYDTPGGEPIGSIISNYAFDRSPQDIALLRNISKVSAAAH
MPFIGSVSPKFFGKDSMEDVASIRDIGNYFDRAEYLKWKSFRDSDDARYIGLTLPRFLARLPYGPETVPV
RAFNYTEAVKGPDHNRYLWANASFAFAANMVQSFIKNGWCVQIRGPQAGGLVEDLPIHLYDLGTGNQAKI
PTEVLIPETREFEFANLGFIPLSYYKNHDFACFFSAHSTQKPALYDTSEATANSRVNARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVKTLVTEMTDPGDELQASHPLREAKVIVEDIEDNPGFFRVKLF
IVPHFQIEGMDINLSLVSQMPKAKN
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2017834-2016287 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGGCCAAACAAGAGATTTCCGCACTCGCTCACAGCGAGGTTGACACCGTTGTGCTGGACGCGCCTGGCA
AGACCGTCTACGAATCCCTTTGCGAGAAGATCAACCTGACCCCGGTCAGGAGCGCACGTCCGGTGGAATC
CTTCCAGAGCCCAGAAGCATTGTCCGATTCATCGCTGGATGAGCGTGTTGCGCAAGCGATGCACGTATTC
CTGAAAATGATCCAGGATTCATCGCAGCAGGTGGACCGGCTCGATAAGAGCCTGCTGGATTTTCATATCG
CGCACCTGGACGAGCAGATCAGCCGCCAGCTTGATGCAATCATGCACCACGAAACATTCCAGCAGATCGA
GTCTGCGTGGCGCGGGCTGAAGTTCCTGGTCGACCGCACGGACTTCCGCAAGAACGTCAAGATCGAGGTG
CTGGATGCTTCCAAGGAAGCATTGCGCCAGGACTTCGAAGACACGCCGGAAGTGATCCAGAGCGGCTTGT
ACCTGCATACATACATCCAGGAATACGACACGCCGGGCGGCGAGCCGATCGGCTCGATCATCTCCAACTA
CGCGTTCGATCGCAGCCCCCAGGATATCGCCCTGCTGCGCAATATCTCGAAGGTTTCGGCGGCGGCCCAC
ATGCCGTTCATTGGATCGGTGTCACCGAAGTTCTTTGGTAAGGACTCGATGGAGGACGTGGCCAGCATTC
GAGACATCGGCAATTATTTTGACCGTGCGGAATACCTGAAGTGGAAGAGCTTCCGCGATTCCGACGATGC
CCGCTACATCGGCCTGACGCTGCCGCGCTTCCTCGCACGTTTGCCCTATGGTCCCGAAACGGTGCCAGTG
CGCGCCTTCAACTATACCGAGGCCGTCAAGGGCCCCGATCACAATCGCTATCTGTGGGCGAATGCCTCGT
TCGCCTTTGCCGCAAACATGGTGCAAAGCTTCATCAAGAACGGCTGGTGCGTGCAGATTCGCGGCCCCCA
GGCCGGCGGCCTGGTGGAGGACCTGCCGATCCACTTGTATGACCTGGGTACCGGTAATCAGGCCAAGATC
CCCACCGAGGTGCTGATCCCGGAAACGCGCGAGTTCGAGTTCGCCAATCTGGGCTTCATCCCGCTGTCGT
ACTACAAGAACCACGACTTCGCTTGCTTCTTCTCGGCGCACTCCACGCAGAAGCCGGCGCTCTATGACAC
CAGCGAGGCCACGGCCAACAGCCGGGTCAACGCGCGCCTGCCATACATTTTCCTGCTGTCGCGGATCGCC
CATTACCTGAAGCTGATTCAGCGCGAGAACATCGGCACCACCAAGGACAGGCGCCTGCTGGAGCTGGAGC
TGAACACGTGGGTCAAAACGCTGGTGACAGAAATGACCGATCCGGGCGACGAACTGCAGGCCTCGCACCC
GCTGCGCGAGGCGAAGGTAATTGTCGAGGATATCGAGGACAACCCGGGCTTCTTCCGCGTCAAGCTTTTC
ATCGTGCCGCACTTCCAGATCGAGGGCATGGACATCAACCTGTCGCTGGTGTCGCAGATGCCGAAGGCGA
AGAACTGA