SecReT6
Protein ID: 73539089
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5266
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2017859..2018365 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ46QH2
KEGG IDreu:Reut_B5266
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.60E-55, Aligned region: 6..158
Protein Sequence: 168 a.a.     [Download]
>gi|73539089|ref|YP_299456.1| unnamed protein product [Ralstonia eutropha JMP134]
MAESFQNEVPKARINIKLDLHTGGAQKKVELPLKMLVMGDYSNGQDTRALAEREKVSINKNNFNSVLADF
NPKARIAVGNTLAGDGSELPVDLDFKSMDDFKPEVVAGRVPELRALMAARNLLRDLKSNLLDNAMFRREL
EKILKDPSLSERLRADLQRIGENAPSAQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|73537298|ref|NC_007348.1|:c2018365-2017859 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGGCTGAAAGTTTCCAGAATGAAGTGCCCAAAGCACGGATCAACATCAAGCTGGACCTGCATACCGGCG
GTGCGCAGAAGAAGGTCGAGTTGCCGCTCAAGATGCTGGTGATGGGCGACTACAGCAATGGACAGGACAC
CCGCGCCCTTGCAGAGCGTGAGAAGGTCTCGATCAACAAGAACAACTTCAATTCCGTCCTCGCCGATTTC
AATCCCAAGGCCAGGATTGCGGTCGGCAACACGCTGGCCGGCGATGGCTCGGAACTTCCAGTCGACCTTG
ACTTCAAGTCCATGGACGACTTCAAACCGGAAGTTGTGGCGGGCCGCGTACCCGAGTTGCGGGCGTTGAT
GGCCGCGCGTAACCTGCTGCGCGACCTCAAGTCGAATCTGCTCGACAACGCGATGTTCCGCCGCGAGCTG
GAAAAGATCCTCAAGGATCCGTCCCTGTCCGAGCGCCTGCGTGCCGATCTGCAAAGGATTGGCGAGAACG
CCCCGTCCGCCCAGTAA