SecReT6
Protein ID: 73539090
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5267
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2018664..2021132 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ46QH1
KEGG IDreu:Reut_B5267
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 8.50E-50, Aligned region: 558..574
DUF2345 [PF10106], Evalue: 8.50E-50, Aligned region: 603..752
Phage_GPD [PF05954], Evalue: 1.30E-47, Aligned region: 47..346
Phage_GPD [PF05954], Evalue: 1.30E-47, Aligned region: 561..597
T6SS_Vgr [PF13296], Evalue: 1.30E-35, Aligned region: 479..585
T6SS_Vgr [PF13296], Evalue: 1.30E-35, Aligned region: 612..644
T6SS_Vgr [PF13296], Evalue: 1.30E-35, Aligned region: 788..812
Phage_base_V [PF04717], Evalue: 1.40E-11, Aligned region: 392..468
Protein Sequence: 822 a.a.     [Download]
>gi|73539090|ref|YP_299457.1| unnamed protein product [Ralstonia eutropha JMP134]
MASVVEEPKATASDLPKGITGRQAYFLEVPSAPTAAALSVVSFKAVERLGEPYVVTVQLTHPLELDRADY
LGRDAAFVIDAADGDEPRRFAGCITRFAKTRQTRDFAAYEMVVEPLVARLRLTHASRVYQHKTAPQIIEA
ILRRHDLKGHQFAFKTRRQYPQHKFRLQYQMSDWDYIRLLMEQEGLYSYFVPGKFGENWVVADDIDHYLY
QPELRPPYQETAGLESGVEAVYAIKTVARTVAQSVRAADRNPAQAYERFQAEANIARKDRTTYGQPYFYG
THHLDQDSAKWEAQLRHEAAIAGQVVYEGESNVLELRPARILRLNLALLDAPNGQVITEVTHSGARDQAY
RNSFKSIPSDRRFRLPLDEANWPRIAGTLGARVTSPNKYKYAYLTQDGHYTVRFDLDFEEWPSGGESVPL
RLAKPFAGGLQTGFHFPLLDGTEVAIAFTDGNPNKPYIASAHHNSYQGDHITTADRWLSRNVIRTQSNNK
LRMEDWEGQEGIKLSTEYGGKTQLNLGYLVDGKKQKRGDGFELRTSGWGAVRGGKGLLISADDQPNAHGQ
QLDMEAAKGLLQQALQQSEALGAAAKAAEAVAADYARQKALLDESLAQLKRAGILVSAPAGVALASGNDL
QCTAAQNLIATAGSHADFSIAKRFTLAAGDLVSIFAQKLGVKLVAARGKVELQAQSDEMRLLADKHMTIT
SANGRVVIEAKDELLLKCGGSYLRMSSTGIEDGTRGDRTIRSAAFSRQGPSSLAQSMNTWQHAKFNDTYV
LRNPSTGEPLSNSAIEIARGDGTRLKMQTDASGKTPVQKSIFVEPVQIRPLD
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|73537298|ref|NC_007348.1|:2018664-2021132 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGGCTAGTGTGGTGGAGGAACCAAAGGCGACTGCGAGCGATCTGCCCAAGGGAATTACCGGTCGACAGG
CGTATTTCCTGGAGGTCCCCAGCGCGCCCACTGCCGCCGCGCTTTCAGTGGTGTCGTTCAAGGCCGTGGA
GCGCCTGGGTGAACCCTATGTGGTGACCGTGCAGCTGACGCATCCGCTGGAACTGGACCGCGCGGACTAT
CTTGGTCGCGACGCGGCGTTCGTGATCGACGCCGCCGACGGTGACGAGCCTCGCCGGTTTGCCGGCTGCA
TTACCCGCTTCGCCAAGACCAGGCAGACGCGCGACTTCGCTGCCTATGAAATGGTGGTGGAACCCCTCGT
GGCGCGCTTGCGGCTCACGCATGCCAGCCGTGTCTATCAGCACAAGACCGCGCCGCAGATCATCGAGGCC
ATCCTGCGGCGGCACGACCTCAAGGGACACCAGTTCGCCTTCAAGACGCGCCGCCAGTATCCGCAGCACA
AGTTCCGGCTCCAGTACCAGATGTCCGACTGGGACTACATCCGCCTGCTGATGGAGCAGGAAGGGTTGTA
CAGCTACTTCGTTCCGGGCAAATTCGGGGAAAACTGGGTGGTGGCGGACGATATCGACCACTACCTTTAT
CAGCCGGAACTGCGGCCACCGTATCAGGAGACAGCGGGGCTGGAATCCGGGGTGGAAGCCGTCTACGCCA
TCAAGACCGTCGCCAGGACGGTGGCGCAATCGGTCCGGGCCGCTGACCGCAACCCGGCGCAGGCCTACGA
GCGCTTCCAGGCCGAGGCGAACATCGCGCGCAAGGACCGCACGACTTACGGCCAGCCATACTTCTATGGC
ACGCACCACCTGGATCAGGACAGCGCCAAGTGGGAAGCGCAGCTACGCCACGAGGCAGCCATTGCCGGGC
AAGTCGTCTATGAGGGCGAGAGCAACGTGCTGGAGTTGCGCCCGGCACGCATCCTGCGCCTGAACCTTGC
GCTCCTCGATGCGCCCAACGGTCAGGTGATCACCGAGGTCACGCACAGCGGCGCGCGCGATCAGGCCTAC
CGCAATTCCTTCAAGTCCATTCCGTCCGACCGGCGCTTCCGGCTGCCGCTAGACGAAGCGAACTGGCCGC
GCATTGCAGGCACGCTCGGTGCACGCGTCACGTCACCGAACAAGTACAAGTACGCCTACCTGACCCAGGA
CGGGCATTACACGGTGCGCTTCGACCTGGACTTCGAGGAGTGGCCCTCCGGCGGCGAGAGCGTGCCGCTA
CGCCTCGCCAAACCCTTCGCTGGCGGCCTTCAGACTGGCTTCCACTTCCCGCTGCTGGACGGAACTGAGG
TGGCCATTGCCTTCACGGACGGGAACCCGAACAAGCCCTATATCGCGTCGGCCCACCACAACAGCTATCA
GGGCGACCACATCACGACCGCGGACCGGTGGCTGTCGCGCAATGTTATCCGCACGCAGAGCAACAACAAG
CTGCGCATGGAGGATTGGGAGGGCCAGGAAGGCATCAAGCTCTCGACGGAGTACGGCGGCAAGACCCAAC
TCAATCTGGGCTACCTGGTTGACGGCAAGAAGCAGAAACGCGGCGACGGCTTTGAATTGCGCACGTCCGG
ATGGGGTGCCGTGCGTGGGGGCAAGGGTCTGCTGATCTCGGCAGATGACCAGCCGAACGCCCACGGCCAG
CAACTTGATATGGAGGCTGCAAAGGGGCTACTGCAGCAGGCGCTTCAGCAAAGCGAGGCGTTGGGTGCTG
CGGCCAAGGCAGCCGAGGCGGTAGCCGCTGACTACGCTAGGCAGAAAGCCCTCCTCGATGAGTCTCTCGC
ACAACTCAAGAGAGCGGGAATTCTCGTCAGTGCTCCTGCCGGCGTGGCGCTGGCCTCCGGTAATGACCTG
CAATGCACAGCCGCCCAAAACCTCATTGCTACGGCGGGCAGCCACGCGGATTTCAGCATCGCAAAACGCT
TCACGCTGGCTGCGGGCGACTTGGTGTCCATCTTTGCCCAGAAGCTGGGCGTCAAGTTGGTTGCTGCGCG
GGGAAAGGTTGAACTCCAGGCCCAGAGCGACGAAATGCGTCTTCTCGCGGATAAACACATGACGATTACC
AGTGCAAATGGTCGCGTCGTCATCGAGGCAAAGGACGAGCTGCTGCTCAAGTGTGGCGGCTCGTATCTGC
GAATGTCGTCAACCGGGATCGAGGACGGAACGCGCGGAGACCGGACCATCAGGTCGGCGGCATTCAGCCG
CCAGGGACCCAGCTCGCTGGCTCAGTCGATGAACACGTGGCAGCACGCAAAATTCAATGACACCTATGTC
CTTCGGAATCCATCGACAGGGGAGCCACTCTCCAACTCTGCCATTGAAATAGCCAGAGGCGACGGCACGA
GACTCAAGATGCAAACGGACGCGTCCGGCAAGACGCCAGTCCAGAAGAGCATCTTCGTGGAGCCCGTACA
AATTCGTCCGCTCGACTAA