SecReT6
Protein ID: 73539095
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5272
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2029244..2030818 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ46QG6
KEGG IDreu:Reut_B5272
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-16, Aligned region: 66..123
ImpA-rel_N [PF06812], Evalue: 1.40E-16, Aligned region: 156..180
ImpA-rel_N [PF06812], Evalue: 1.40E-16, Aligned region: 226..239
ImpA-rel_N [PF06812], Evalue: 1.40E-16, Aligned region: 396..418
Protein Sequence: 524 a.a.     [Download]
>gi|73539095|ref|YP_299462.1| unnamed protein product [Ralstonia eutropha JMP134]
MFNHLLNALFGSRTPTDLARSTQVRWEPWLQPIRPEAPVGDDPGYDDDFLAIKEEVARLSDINDSLIIDT
AERLLKASAKDVRLAAYYAYGRMRRDGAEGVASAFELLSALIDRFGEQLLPARAESRKAALEWLAGATFT
DRLDRVSGLSGTYLERTLSALALMQERTAQWPEAARPALDTLFRRFEGRVESPSAADSDSHAVPVKAPAI
ATTLASAKVTSTRELLDGARQMAQFLRDQPEGYLAAYRLMRCVRWDTLTEVPPHEAGGRTRLVAPRAELR
AHMKRLVLQKQWPELLDRVEQAFAEGTNHFWLDLQYYAFAAQDQAGGQYARVRDLLATDCALMLERLPGL
DQLAFADGTPFADDTTLEWIARHATVRDIERGETVAPVAVDSASTDWAETEAQAAELAAQQSLDAALAWL
QGLPASDGERERFLRQLVMARVAERADRADTALHLLAALDQSAHHYRLATWEPSLAFEVKHQMVRLLRSR
LTRKDADKPALAQRIDALMGELTAIDPARAVAMA
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|73537298|ref|NC_007348.1|:2029244-2030818 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGTTCAACCATCTTCTCAATGCGCTGTTCGGCTCGCGCACGCCCACGGACCTCGCACGTTCCACGCAGG
TGCGCTGGGAACCCTGGCTTCAGCCTATCCGCCCCGAGGCGCCGGTCGGCGATGACCCCGGCTATGACGA
CGATTTCCTCGCCATTAAGGAGGAGGTCGCCAGGCTGTCGGACATCAACGATAGCCTGATCATCGACACG
GCAGAGCGGTTGCTCAAGGCCAGCGCCAAGGATGTACGACTGGCGGCCTATTACGCCTACGGTCGCATGC
GGCGGGATGGGGCGGAAGGCGTGGCCTCGGCCTTTGAACTGCTGTCGGCACTGATCGACCGGTTCGGGGA
ACAGTTGCTGCCGGCCCGCGCGGAAAGCCGCAAGGCCGCCCTGGAGTGGCTCGCTGGCGCCACCTTCACG
GATCGCCTCGACCGCGTCTCTGGACTGAGCGGGACTTACCTGGAGCGCACCCTGTCGGCGCTGGCGCTGA
TGCAGGAGCGCACCGCACAGTGGCCGGAAGCGGCCCGTCCGGCGCTGGATACGCTATTTCGCCGGTTCGA
GGGCCGGGTCGAGTCTCCATCAGCCGCGGATAGCGATAGTCACGCAGTGCCCGTCAAGGCGCCGGCAATC
GCGACGACGCTCGCCTCGGCCAAGGTGACCTCCACGCGGGAGCTCCTGGACGGCGCGCGCCAGATGGCGC
AGTTCCTGCGCGATCAGCCGGAAGGCTATCTGGCTGCCTACCGCCTGATGCGTTGCGTACGCTGGGACAC
GCTGACCGAGGTCCCGCCGCATGAGGCCGGTGGCAGGACGCGGCTCGTGGCACCGCGTGCCGAACTACGC
GCCCACATGAAGCGGCTGGTCCTGCAGAAGCAGTGGCCGGAACTGCTCGACCGGGTCGAGCAGGCCTTTG
CCGAGGGGACCAATCACTTCTGGCTCGATCTGCAGTACTACGCGTTCGCCGCCCAGGACCAGGCCGGCGG
CCAGTACGCACGCGTGCGCGACCTGCTGGCCACCGATTGCGCGCTGATGCTGGAGCGGCTGCCGGGCCTC
GATCAACTTGCCTTTGCCGATGGGACGCCGTTCGCGGACGACACTACGCTGGAATGGATCGCCCGCCATG
CCACCGTGCGCGATATCGAGCGCGGTGAGACTGTAGCCCCCGTGGCAGTGGATTCGGCCAGCACGGATTG
GGCGGAAACCGAGGCCCAGGCCGCAGAGCTGGCCGCACAGCAAAGCCTCGATGCGGCCCTGGCGTGGTTG
CAGGGCCTGCCCGCGTCGGACGGCGAGCGCGAACGCTTTTTGCGCCAGCTGGTGATGGCGCGCGTGGCGG
AGCGTGCCGATCGCGCGGATACCGCCCTGCACCTGCTTGCCGCGCTGGACCAGAGCGCTCATCACTATCG
GCTGGCAACCTGGGAGCCGTCGCTGGCGTTCGAGGTCAAGCATCAAATGGTGCGGCTGCTGAGATCCCGC
CTGACGCGCAAGGATGCCGACAAGCCCGCCCTGGCGCAGCGCATCGATGCCCTGATGGGCGAGCTGACCG
CCATTGACCCGGCCCGCGCCGTCGCCATGGCCTGA