SecReT6
Protein ID: 73539096
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5273
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2030836..2032662 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ46QG5
KEGG IDreu:Reut_B5273
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-183, Aligned region: 13..606
Protein Sequence: 608 a.a.     [Download]
>gi|73539096|ref|YP_299463.1| unnamed protein product [Ralstonia eutropha JMP134]
MPMNHPTQDNDILRYYEAEMRYLREAGKEFAQAFPDRARMLNIDRIGERDPHVERLFEGFAFLMGRLRHK
LDDELPELTEGLVSMLWPHYLRMIPSLSILELIPSPGVLQGHETLAAGLEAVSDPVLLGSQQGIGNSVEC
IYRTTQPVDLYPLSVAEAGTYAREDGRSVIHLRLARQAQSRQEQLKVPRLRLYLHADRPVALALYAALTA
QPLAMHVRIPGYPIDRPGAPQSMTGLRLAPVGFGASERLWPKPDNAFGGYQLLLEYFTFPEKFMFVDLLG
LDMAAIPSDVQHFDVEVVLAKLFPDDMRFSAENIRLFCTPVINLFELEADPITVTHHETEYRVRTMEQHG
QHVEAYSVDTVRGFDAATGERFEYAPFAAFRHRGGMLRHDMPERYFHTRVRRGPSGRFDTWLVLGGHAWE
QQDTLPQETLSLSVTGTNGMLPRKGLREAGICRMGGGFTNIGAVRNLTAPTLPVYPPTGDRFHWRVLSHL
APNYLSLLDAEVLRGSLALYDWTDGELNRRRIDAITDVRHRPLQKLVKGGLQRGVEIEVSLDSTRFAGDG
DVELFGEMLNRFLALYATLNLYTRLVVVSQPSGKRLEWPDSKGEGAPF
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|73537298|ref|NC_007348.1|:2030836-2032662 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGCCCATGAATCACCCCACCCAAGACAACGACATCCTGCGCTATTACGAGGCCGAGATGCGCTACCTGC
GCGAGGCCGGCAAGGAATTCGCCCAGGCGTTCCCCGACCGCGCGCGGATGCTCAATATCGACCGCATCGG
CGAACGCGATCCCCACGTCGAACGTCTGTTCGAGGGCTTCGCCTTCCTGATGGGGCGGCTGCGCCACAAG
CTCGACGACGAGTTGCCGGAACTGACGGAAGGCCTGGTCAGCATGCTGTGGCCGCACTACCTGCGCATGA
TCCCGTCGCTGTCGATCCTGGAACTGATCCCGAGCCCCGGCGTGCTGCAAGGTCACGAGACCCTGGCGGC
CGGGCTGGAGGCTGTGTCCGATCCGGTCTTGCTGGGGTCGCAGCAAGGCATCGGCAACAGCGTGGAATGC
ATCTACCGGACAACCCAGCCTGTCGATCTGTACCCGCTTAGCGTGGCCGAAGCGGGTACCTACGCACGCG
AGGACGGCCGCTCCGTCATTCATCTGCGCCTGGCCCGGCAGGCCCAGTCGCGGCAGGAACAGCTGAAGGT
GCCCCGGCTGCGGCTTTATCTGCATGCGGATCGTCCCGTGGCGCTGGCACTCTACGCGGCGCTGACTGCG
CAACCGCTGGCCATGCACGTTCGCATTCCCGGCTACCCGATCGACCGGCCAGGCGCACCGCAGTCCATGA
CGGGCCTGCGCCTGGCGCCGGTGGGATTTGGCGCCAGCGAGCGGCTCTGGCCCAAGCCCGACAATGCCTT
CGGCGGTTACCAGCTGCTGCTGGAGTATTTCACGTTCCCCGAGAAGTTCATGTTTGTGGACCTGCTCGGG
CTCGACATGGCGGCAATCCCGTCAGATGTTCAGCACTTCGATGTCGAAGTCGTTCTCGCCAAGCTGTTTC
CGGATGACATGCGCTTCTCGGCCGAGAACATCCGGCTTTTCTGCACACCTGTCATCAACCTGTTCGAGCT
GGAGGCCGATCCGATCACGGTCACTCACCATGAGACCGAATACCGGGTGCGGACCATGGAACAACACGGT
CAGCATGTCGAGGCCTACTCGGTCGATACCGTGCGCGGATTCGACGCAGCGACCGGCGAGCGCTTCGAGT
ACGCGCCATTCGCCGCTTTCCGGCACCGAGGCGGGATGCTGCGCCATGACATGCCCGAGCGCTACTTTCA
TACGCGTGTACGAAGGGGGCCGTCCGGGCGCTTCGATACCTGGCTCGTGCTTGGAGGGCATGCCTGGGAG
CAGCAGGACACGTTGCCGCAGGAAACCCTGTCCCTGTCGGTCACCGGTACGAACGGCATGCTGCCGAGAA
AGGGGTTGCGCGAGGCCGGCATCTGCCGCATGGGCGGCGGCTTCACCAATATCGGCGCCGTGCGCAACCT
GACGGCGCCCACCTTGCCGGTGTACCCGCCGACCGGCGACCGATTTCATTGGCGCGTGCTGTCGCACCTG
GCGCCCAATTATCTGTCCCTCCTTGATGCCGAGGTGCTGCGTGGCAGTCTGGCGCTCTACGACTGGACCG
ACGGCGAGCTGAACCGGCGCAGGATCGATGCCATCACCGACGTCCGCCATCGCCCGCTGCAGAAACTGGT
GAAGGGCGGACTGCAGCGCGGAGTGGAAATCGAGGTGAGCCTGGACAGCACCCGCTTCGCCGGCGACGGC
GATGTGGAATTGTTCGGCGAAATGCTGAACCGCTTCCTGGCGCTTTATGCCACCCTGAACCTGTACACCC
GCCTGGTCGTTGTCTCGCAGCCCAGCGGCAAGCGGCTCGAATGGCCCGACAGCAAAGGTGAGGGGGCCCC
GTTTTGA