SecReT6
Protein ID: 73539097
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5274
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2032659..2033708 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ46QG4
KEGG IDreu:Reut_B5274
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-88, Aligned region: 20..316
Protein Sequence: 349 a.a.     [Download]
>gi|73539097|ref|YP_299464.1| unnamed protein product [Ralstonia eutropha JMP134]
MNSTEKCTMDTGSLLPALLANAPRMNFFRLCELIELAAPERPPLGTTDSPADEPVRFRSSGQLGFPGREI
DRVERDADQPALPPVLRTTFLGLYGVDARMPSYFVDEIAQRRDGAEPLAAFLDLFHHRITTQFYRVGRKY
RYPVGFRTGGEDKVSRCLLSLLGLGIGQSPVEQSVPTRKLLSMLGLASQRTRTAEGLAGVLQHAVPDAMI
TVTEFHPVWVRLDTHEQQPLGENCVLGRGFLDRTNTVLVVITPNRRDSVLGLMPGRRLHQEVMGVLRFYL
GYAAHAHLEMHVRRSLMPPPALNSNDASLGLTTQLRRHTGESDAPVDDPVTRVKLGTWTGHPAPVSGPH
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|73537298|ref|NC_007348.1|:2032659-2033708 Ralstonia eutropha JMP134 chromosome 2, complete sequence
TTGAACTCCACTGAGAAGTGCACCATGGATACCGGTAGCCTGCTGCCGGCGTTGCTTGCCAATGCGCCGC
GGATGAATTTTTTCCGGCTGTGCGAGCTGATCGAGCTGGCCGCACCGGAGCGCCCACCGCTGGGCACCAC
CGATTCGCCTGCCGACGAGCCGGTTCGATTCCGTTCGTCCGGACAGCTCGGATTTCCGGGGCGGGAAATC
GATCGCGTCGAGCGGGATGCGGACCAACCCGCCTTGCCGCCGGTGCTTCGGACGACTTTCCTTGGCCTCT
ACGGCGTCGATGCCCGCATGCCGTCCTACTTTGTGGACGAGATTGCCCAGCGCCGGGACGGCGCGGAACC
CCTGGCCGCGTTCCTGGACCTGTTCCACCATCGGATCACCACGCAGTTCTACCGCGTGGGACGCAAGTAC
CGCTATCCGGTGGGCTTCCGCACCGGCGGCGAAGACAAGGTGTCGCGCTGTCTGCTGAGCCTGCTGGGAC
TCGGCATCGGCCAGTCGCCGGTCGAGCAATCGGTGCCGACGCGCAAGCTCCTGTCGATGCTGGGACTCGC
CAGCCAGCGTACGCGTACTGCGGAGGGGCTCGCAGGTGTGCTGCAGCATGCGGTGCCGGATGCCATGATC
ACAGTCACGGAATTTCATCCTGTGTGGGTGCGTCTGGATACGCACGAACAGCAGCCGCTTGGGGAGAACT
GCGTGCTCGGACGCGGCTTCCTTGACCGCACCAACACCGTACTCGTGGTGATCACCCCGAACCGGCGCGA
CTCGGTACTCGGGCTGATGCCGGGCCGACGCCTCCATCAGGAGGTGATGGGCGTGCTGCGCTTCTACCTC
GGCTACGCAGCGCATGCCCACCTGGAAATGCATGTGAGACGTTCATTGATGCCACCGCCCGCGTTGAACT
CGAACGATGCCAGCCTCGGCTTGACTACGCAATTGAGGCGGCACACAGGTGAATCTGACGCACCGGTCGA
TGATCCGGTGACGCGCGTGAAACTTGGCACCTGGACGGGCCATCCGGCGCCGGTGTCCGGACCACACTGA