SecReT6
Protein ID: 73539098
SecReT6 ID89
T6SS typei2
Gene symbol-
Locus tagReut_B5275
StrainRalstonia eutropha JMP134
Repliconchromosome II [GenBank: NC_007348] [Browse all T6SS(s) in this replicon]
Location [Strand]2033721..2034359 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ46QG3
KEGG IDreu:Reut_B5275
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-36, Aligned region: 28..176
Protein Sequence: 212 a.a.     [Download]
>gi|73539098|ref|YP_299465.1| unnamed protein product [Ralstonia eutropha JMP134]
MEHSNMKTQRINTMTWQLRSCIAALGFTLLTGCGVGQAVKDGTVDAAKWMFTTQVKTMNIDLVSRSSLNA
SGAGRSLSTVVRVYQLRTPQTFEQLSYEQLQANDLDMLKMDLLATRDVVLRPDAAASISEPMNEATEYVG
VAAFFRDTGKSGTWKLIIPRQQWKKTDPVKIDATDNVLQLAGMKPEPIRQAALQHSVPNPQTSAQTASAR
KE
 
Nucleotide Sequence: 639 bp     [Download]
>gi|73537298|ref|NC_007348.1|:2033721-2034359 Ralstonia eutropha JMP134 chromosome 2, complete sequence
ATGGAACACAGCAACATGAAAACACAGAGGATCAACACAATGACGTGGCAATTGCGAAGCTGCATCGCGG
CGCTGGGCTTCACCCTTTTAACTGGCTGCGGCGTGGGCCAGGCCGTGAAGGACGGCACAGTGGATGCGGC
GAAGTGGATGTTCACGACGCAGGTCAAGACCATGAACATCGACCTCGTCAGCCGGTCGTCGTTGAATGCA
AGTGGCGCTGGACGATCGCTGTCGACCGTGGTGCGGGTCTACCAGTTGAGGACGCCGCAAACGTTCGAAC
AGCTCAGCTACGAACAACTCCAAGCGAATGACCTCGACATGCTGAAGATGGATTTGCTTGCCACCAGGGA
TGTCGTGCTCAGGCCTGACGCCGCTGCGAGCATCAGCGAGCCCATGAACGAGGCCACCGAGTACGTCGGC
GTGGCTGCGTTCTTCCGCGATACGGGCAAGAGCGGGACATGGAAACTCATCATCCCCAGGCAGCAATGGA
AGAAGACCGATCCGGTGAAGATCGACGCGACCGACAATGTGCTGCAACTGGCAGGCATGAAGCCGGAACC
AATCAGGCAGGCGGCGCTGCAGCACAGCGTACCGAATCCGCAGACGTCTGCGCAGACGGCGAGCGCTCGC
AAGGAATGA