SecReT6
Protein ID: 73541403
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1714
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1848935..1850086 [-]
ProductImpA-like protein
NoteTssA
UniProt IDQ470V4
KEGG IDreu:Reut_A1714
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.00E-21, Aligned region: 69..128
Protein Sequence: 383 a.a.     [Download]
>gi|73541403|ref|YP_295923.1| unnamed protein product [Ralstonia eutropha JMP134]
MTMRPPNLAEAAGVPLLDLEALISPVPGDARAGISLRYDALYPAIRAARHQDDATLPMGEWERPLAKADW
GRVAALCSEALVGRSKDFQLAAWLCEAWTHMHGVAGVVAGTRALSALAQHYWDDGHPAIEHGDSDARCAP
FAWLNETLPLVLALHVPLLVLPDLDVPTVSLERWERTATGGEEGLNRDSLVRRAGEGRNQAALVAMRRQL
DAAMQGWHEFDLAIDARLGGEAPSLRRVPEALQRLQRAVATLLQGYDEVLQGQAPDAGASAVMDAAADIA
TEASMNEWQEPIRTATQPLATASVAGAGLAAGQPANGIANRTHAYRLLEEIADFLAQNEPHSPTPYLLRR
AVSWGQMPLAELMRDILREDGDVHRYLALLEQQ
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1850086-1848935 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGACCATGAGACCGCCGAATCTGGCCGAAGCCGCGGGCGTGCCGCTGCTGGACCTTGAAGCCCTGATCA
GCCCGGTTCCGGGCGACGCGCGCGCCGGCATCTCGCTGCGCTACGACGCCCTCTATCCGGCAATCCGCGC
CGCGCGACATCAGGATGACGCCACGCTGCCAATGGGCGAGTGGGAGCGCCCACTGGCCAAGGCTGACTGG
GGCCGCGTGGCCGCGCTGTGCAGCGAGGCGCTGGTCGGGCGCAGCAAAGACTTCCAGCTAGCCGCCTGGC
TGTGCGAGGCCTGGACCCACATGCACGGTGTGGCCGGCGTTGTGGCAGGCACGCGTGCCCTCAGCGCGCT
GGCGCAGCACTACTGGGACGACGGCCATCCCGCCATCGAGCACGGCGACAGCGACGCGCGCTGCGCGCCC
TTCGCCTGGCTCAACGAGACGCTGCCGCTGGTGCTGGCGCTGCACGTGCCGCTGCTGGTCTTGCCCGATC
TGGATGTGCCCACGGTCTCTCTGGAGCGCTGGGAACGGACGGCCACGGGCGGTGAGGAGGGGCTGAACCG
CGACTCCCTGGTGCGGCGCGCCGGCGAGGGGCGCAACCAGGCTGCGCTGGTGGCAATGCGGCGCCAGCTC
GACGCTGCCATGCAGGGTTGGCACGAGTTCGATCTCGCCATCGATGCCCGGCTTGGCGGCGAAGCCCCCA
GCCTGCGGCGCGTGCCGGAGGCGCTCCAGCGCCTGCAGCGCGCTGTCGCCACGCTGCTGCAGGGGTATGA
CGAAGTGCTGCAGGGACAGGCGCCGGACGCCGGTGCGTCGGCGGTCATGGATGCCGCAGCGGACATCGCA
ACGGAGGCCAGCATGAATGAATGGCAGGAGCCGATACGCACTGCGACTCAACCCTTGGCCACGGCCTCAG
TGGCCGGCGCCGGCTTGGCCGCAGGCCAGCCGGCGAACGGCATTGCGAACCGGACCCATGCCTACCGGCT
GCTCGAGGAAATCGCTGATTTCCTTGCGCAGAACGAGCCGCATAGCCCTACGCCTTACCTGCTCAGGCGC
GCGGTGAGCTGGGGCCAGATGCCGCTTGCAGAACTGATGCGCGACATCCTGCGCGAGGACGGCGACGTCC
ATCGCTACCTGGCGTTGCTGGAACAGCAATAG