SecReT6
Protein ID: 73541405
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1716
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1854280..1855032 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ470V2
KEGG IDreu:Reut_A1716
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-39, Aligned region: 18..234
Protein Sequence: 250 a.a.     [Download]
>gi|73541405|ref|YP_295925.1| unnamed protein product [Ralstonia eutropha JMP134]
MARYRPEAEDDDLAGEQFRAFLDELVNAQARLSESADATPEAVAQGMSRHLLNLLELQTLQSRRDSTRFE
MEDVADARYLKAVLADEILLNTDWAGQAQWHAHLLESTLFRTNIAGDEVFRRIEQLLLDREPSRRKLARL
YLSALALGFQGRFRGADADARLRSLREELYEFVYQRRPDLSGRDRVVSEAAYAHTLSHIAPRKLPTMTRW
TVVFALSLVSLLALSEVLWLWQSWPLRQALRADTVVGANP
 
Nucleotide Sequence: 753 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1855032-1854280 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGCACGCTATCGACCCGAAGCCGAGGACGACGATCTCGCCGGCGAGCAGTTCCGCGCCTTCCTGGACG
AACTGGTCAATGCCCAGGCGCGCCTGTCCGAGAGTGCCGACGCCACGCCCGAGGCGGTGGCGCAGGGCAT
GAGCCGCCACCTGCTGAACCTGCTGGAGTTGCAGACTTTGCAGTCGCGCCGCGACAGCACGCGCTTCGAG
ATGGAGGACGTCGCCGACGCCCGCTACCTGAAGGCGGTGCTCGCCGACGAGATCCTGCTCAACACCGATT
GGGCGGGCCAGGCGCAGTGGCATGCCCACCTGCTGGAATCGACGCTGTTCCGCACCAATATCGCCGGCGA
TGAGGTGTTCCGCCGCATTGAGCAGTTGCTGCTGGATCGCGAGCCATCGCGCCGAAAGCTGGCCCGGCTG
TACTTGTCTGCGCTGGCGCTGGGCTTTCAGGGGCGCTTTCGCGGCGCTGATGCCGACGCACGCCTGCGCA
GTCTGCGCGAGGAGTTGTATGAGTTTGTCTACCAGCGCCGTCCCGACTTGAGCGGGCGCGACCGCGTGGT
CAGCGAGGCCGCGTACGCGCACACGCTATCCCATATCGCGCCGCGCAAGCTGCCTACCATGACGCGCTGG
ACCGTGGTGTTCGCGCTCAGCCTGGTCAGCCTGCTGGCCCTGTCCGAGGTGCTGTGGCTGTGGCAGTCGT
GGCCGCTGCGCCAGGCATTGCGCGCCGATACGGTGGTGGGAGCCAATCCATGA