SecReT6
Protein ID: 73541406
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1717
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1855058..1856386 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ470V1
KEGG IDreu:Reut_A1717
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.90E-76, Aligned region: 23..420
Protein Sequence: 442 a.a.     [Download]
>gi|73541406|ref|YP_295926.1| unnamed protein product [Ralstonia eutropha JMP134]
MRDNLTLVDRVEWHEGMLLAPQHFQLLAARLDSLVAWQTLAAAPFSWGVRRLVFDTGLLPVGIVRVLQLD
AVMPDGTAVSYSGDDERLGPLELSLAPFAEQLASGTVDIHLVLPVAGTMRRDAQVRRFRSVLGAPVEDEV
SQAPPADIARLVPNLALSAGAQPSSLYVSLCLGTAYKDNEVVRLGERLPPLLEVGRETPLWTAVASMLGQ
LRSKAAFVAKQTAVPSSKADDRLTQLELRDRLRCLLSELPLVEAVLRTPHLHPLALYLALASLLGSLSML
RPGALPPVPHDYDHANPMTAFAPLLRAVRESLAEVSEAYREHKFEFRHGAFEIALQPDWIGEHLVVGLRG
QSERDLRTWMDGAMVGSQSAYPSLRAHRVLGAARRVVEHADELGVRAGSGYVLFEIETDPALIHGNEALV
IGNPNEGASAQRPQEVLLFVKG
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1856386-1855058 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGCGTGACAACCTGACGCTGGTTGACCGTGTCGAATGGCACGAAGGGATGCTGCTGGCACCGCAGCATT
TCCAGTTGTTGGCAGCCCGCCTCGATTCGCTGGTGGCCTGGCAGACGCTGGCAGCAGCCCCGTTCAGCTG
GGGCGTTCGGCGCCTGGTGTTCGACACGGGCCTGCTGCCGGTCGGCATCGTGCGCGTGCTGCAACTCGAC
GCGGTGATGCCGGATGGCACCGCGGTCTCCTACAGTGGCGACGATGAACGGCTAGGGCCGCTGGAACTGT
CGCTGGCGCCGTTTGCCGAGCAACTGGCCAGTGGCACGGTCGACATCCACCTGGTGCTGCCGGTGGCGGG
AACCATGCGGCGCGACGCACAGGTGCGGCGCTTCCGCTCGGTGCTCGGCGCCCCGGTCGAGGACGAGGTA
TCGCAGGCGCCGCCGGCGGACATTGCACGGCTGGTGCCCAACCTCGCCCTCAGTGCCGGCGCACAGCCAT
CCTCGCTCTATGTATCGCTGTGCCTGGGCACCGCCTACAAGGACAACGAAGTGGTGCGGCTGGGGGAGCG
CCTGCCACCGCTGCTCGAGGTGGGGCGCGAGACCCCTTTGTGGACGGCGGTGGCGTCGATGCTCGGGCAG
TTGCGCAGCAAGGCCGCATTCGTTGCCAAGCAGACCGCGGTGCCATCGTCCAAGGCCGACGATCGCCTGA
CCCAGCTTGAACTCCGGGACCGGCTGCGCTGCCTGCTGAGCGAGCTGCCGCTGGTCGAGGCGGTTCTGCG
CACGCCCCATCTGCATCCGCTTGCGCTGTACCTCGCGCTCGCCTCGCTGCTGGGCTCGCTCAGCATGCTG
CGCCCCGGTGCGCTGCCGCCGGTGCCGCACGATTACGACCACGCCAACCCTATGACCGCGTTCGCGCCGC
TGCTGCGTGCGGTGCGCGAGTCGCTGGCAGAGGTCAGCGAAGCCTACCGCGAGCACAAGTTCGAGTTCCG
CCACGGCGCGTTCGAGATCGCGTTGCAACCTGACTGGATCGGCGAACACCTGGTGGTGGGGCTGCGCGGC
CAGTCCGAGCGCGACTTGCGGACATGGATGGATGGCGCCATGGTGGGCTCGCAGTCGGCCTATCCGTCGT
TGCGTGCGCACCGCGTGCTCGGCGCCGCGCGCCGCGTCGTCGAGCATGCCGACGAACTCGGCGTGCGCGC
TGGCTCCGGCTATGTGTTGTTCGAGATCGAGACCGATCCGGCGCTGATCCACGGCAACGAGGCCCTGGTG
ATCGGCAATCCGAACGAAGGTGCCAGCGCGCAGCGGCCGCAGGAAGTACTGCTGTTCGTCAAGGGATGA