SecReT6
Protein ID: 73541413
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1724
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1861754..1862140 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ470U4
KEGG IDreu:Reut_A1724
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 2.50E-33, Aligned region: 5..123
PAAR_motif [PF05488], Evalue: 0.005, Aligned region: 29..38
PAAR_motif [PF05488], Evalue: 0.005, Aligned region: 65..113
Protein Sequence: 128 a.a.     [Download]
>gi|73541413|ref|YP_295933.1| unnamed protein product [Ralstonia eutropha JMP134]
MGIQVNTGTTMQCSFGAAPSALCVLPVNRVMAGAPAANVMDNKPIVNIPPFGSCNSMANPVVAAATAAAL
GALTPMPCVPVTTAPWMPGSPTVLIGGMPALQNSSKLMCAWGGVIQIVAPGQTTVMTA
 
Nucleotide Sequence: 387 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1862140-1861754 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGGCATCCAGGTCAATACCGGCACCACCATGCAGTGCAGCTTTGGCGCAGCGCCGTCGGCGTTGTGCG
TGCTGCCGGTCAATCGCGTTATGGCCGGCGCGCCGGCGGCCAACGTGATGGACAACAAGCCGATCGTCAA
TATTCCGCCATTCGGCAGCTGCAACTCGATGGCCAATCCGGTGGTGGCCGCAGCCACTGCTGCAGCGTTG
GGCGCGCTCACGCCGATGCCCTGCGTGCCGGTGACCACCGCGCCGTGGATGCCGGGCTCGCCTACCGTGC
TGATCGGCGGCATGCCTGCGCTGCAGAACTCATCCAAGCTGATGTGTGCCTGGGGAGGGGTGATCCAGAT
TGTGGCGCCGGGCCAGACCACCGTGATGACTGCCTGA