SecReT6
Protein ID: 73541415
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1726
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1862870..1864798 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ470U2
KEGG IDreu:Reut_A1726
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-74, Aligned region: 32..328
Phage_base_V [PF04717], Evalue: 6.30E-22, Aligned region: 358..451
Gp5_C [PF06715], Evalue: 0.00075, Aligned region: 356..364
Gp5_C [PF06715], Evalue: 0.00075, Aligned region: 527..548
Gp5_C [PF06715], Evalue: 0.00075, Aligned region: 554..573
Protein Sequence: 642 a.a.     [Download]
>gi|73541415|ref|YP_295935.1| unnamed protein product [Ralstonia eutropha JMP134]
MIPATATQSDSFATVTTPFGDDVLLLDGFAGREALSELFSFQLRMRSADKALDASRIVGQKVTVRLQRPG
GFLRCFNGIVTRFAHTGADPSHAFYSAELAPRLWLLTLARDRRIFQNQSALDIIRTVLGEFEVAFDARVT
ASRYPVREYCVQYDESPLQFISRLMEEEGIFYYFTFSDGAHTMVLGDSPSAHAALAHEAELWGGQPGEQA
AGLPMLAAFRMEQGLGPANHVLVDYDYVQAQTSQGSAQPDSSAPGARQYIFPGRHKDASDAARKAAVRVA
AQQVEARSGSGESNCHGLAAGSTFTLNGHVNAALNAEYVVRAVEHSVAGSHYANSFTVFPLAVPFRAPLV
TPRPLVAGTHTATVVGSQGEEIWTDQHGRIKLKFHWDQAPGADQDSSCWVRVAQGMAGQGWGHLFLPRVG
QEVVVSYVDGDPDRPLVTGSVYNGQVTPPVTLPSMQTQSVIRSRTSKNGSAGNELRMEDKAGAEELYLHA
QRDMNVAVENKLSTTVVGAGESHVVQKGDRLVEVQSGNETHKVSGTRSLEVTGDETRTNGAAFTQEVSGA
YKLKVSGDLVIDVTGAITIKSAGSVAIEAGTSLSNKAGTTLANKAGTTLSGEGLTVQQKASASHTVESGG
MLELKGAMVKLN
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1864798-1862870 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGATTCCGGCCACCGCCACCCAGTCCGACAGCTTCGCCACGGTCACCACGCCGTTTGGCGACGATGTGC
TGCTGCTCGACGGATTTGCCGGGCGCGAGGCGCTTTCCGAGCTGTTTTCCTTCCAGCTGCGCATGCGCTC
GGCGGACAAGGCGCTCGATGCCAGCCGCATCGTTGGCCAGAAGGTCACGGTCAGGCTCCAGCGGCCGGGC
GGCTTCCTGCGTTGTTTCAACGGCATCGTGACGCGCTTCGCCCATACCGGCGCCGACCCCAGCCACGCGT
TCTACAGCGCCGAGCTGGCGCCGCGCCTGTGGCTGCTGACGCTGGCGCGCGACCGCAGGATCTTCCAGAA
CCAGAGCGCGCTCGACATCATCCGCACCGTGCTGGGCGAGTTCGAGGTGGCATTCGACGCGCGCGTCACC
GCTTCGCGCTACCCGGTGCGCGAGTACTGCGTGCAGTACGACGAAAGCCCCCTGCAGTTCATCTCGCGGC
TGATGGAGGAAGAGGGCATCTTCTACTACTTCACCTTTTCCGACGGCGCGCACACCATGGTGCTGGGTGA
CAGTCCCTCGGCCCACGCCGCGCTGGCCCACGAGGCCGAGCTGTGGGGCGGCCAGCCGGGCGAGCAGGCG
GCGGGCCTGCCGATGCTGGCGGCCTTCCGCATGGAACAGGGACTCGGTCCGGCCAACCACGTGCTGGTCG
ACTATGACTATGTGCAGGCGCAGACCAGCCAGGGCAGTGCGCAGCCGGACTCGAGCGCGCCCGGCGCGCG
CCAGTACATTTTCCCGGGGCGCCACAAGGATGCCTCGGATGCCGCGCGCAAGGCGGCGGTGCGAGTGGCC
GCACAGCAGGTCGAGGCTCGCTCCGGCAGCGGCGAGAGCAACTGTCACGGCCTTGCCGCAGGGAGTACCT
TCACCCTCAACGGCCACGTCAATGCGGCACTGAACGCCGAGTACGTGGTGCGCGCGGTCGAGCACTCGGT
GGCCGGCAGCCACTATGCCAACAGCTTCACGGTGTTTCCGCTGGCGGTGCCATTCCGCGCGCCGCTGGTA
ACGCCGCGTCCGCTGGTGGCCGGCACCCATACCGCAACCGTGGTCGGCTCCCAGGGCGAGGAAATCTGGA
CGGACCAGCACGGCCGTATCAAGCTCAAGTTCCACTGGGACCAGGCGCCCGGCGCCGACCAGGACAGCTC
GTGCTGGGTCCGGGTGGCGCAGGGCATGGCTGGCCAGGGCTGGGGCCATCTGTTCCTGCCACGCGTGGGG
CAGGAGGTGGTAGTCAGCTATGTCGACGGCGATCCCGACCGGCCGCTGGTGACCGGCAGCGTCTACAACG
GCCAGGTGACGCCGCCGGTGACGCTTCCCTCGATGCAGACCCAGAGCGTGATCCGCTCGCGCACTTCCAA
GAACGGCAGCGCCGGCAACGAGCTGCGCATGGAGGACAAGGCCGGCGCCGAAGAGCTCTACCTGCACGCG
CAGCGCGACATGAACGTGGCGGTGGAAAACAAGCTGTCCACCACCGTGGTCGGCGCTGGCGAGTCGCATG
TTGTCCAGAAGGGTGACCGGCTGGTCGAGGTGCAGTCGGGCAACGAAACTCACAAGGTGAGCGGCACCCG
TAGCCTCGAGGTGACCGGTGACGAGACCCGCACCAACGGCGCCGCCTTCACCCAGGAGGTCAGCGGGGCC
TACAAGCTCAAGGTGTCTGGCGATCTGGTCATCGACGTGACGGGCGCCATCACCATCAAGTCGGCAGGCT
CGGTGGCGATTGAGGCTGGCACTTCGCTGAGCAACAAGGCGGGCACCACGCTGGCAAACAAGGCAGGCAC
TACGCTGAGTGGCGAGGGCCTGACCGTGCAGCAGAAGGCGTCGGCCTCGCACACGGTGGAAAGCGGCGGC
ATGCTGGAGCTCAAGGGCGCCATGGTGAAACTGAACTGA