SecReT6
Protein ID: 73541416
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1727
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1864803..1867499 [-]
ProductATPase AAA
NoteTssH
UniProt IDQ470U1
KEGG IDreu:Reut_A1727
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.10E-37, Aligned region: 228..246
AAA_2 [PF07724], Evalue: 7.10E-37, Aligned region: 625..789
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 228..359
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 631..749
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 274..295
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 797..869
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 228..248
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 630..745
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 63..80
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 206..249
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 272..307
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 357..422
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 599..666
AAA_16 [PF13191], Evalue: 1.60E-11, Aligned region: 694..719
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 227..314
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 350..399
AAA_22 [PF13401], Evalue: 1.50E-09, Aligned region: 629..719
IstB_IS21 [PF01695], Evalue: 6.70E-06, Aligned region: 212..250
IstB_IS21 [PF01695], Evalue: 6.70E-06, Aligned region: 630..648
AAA_17 [PF13207], Evalue: 7.30E-06, Aligned region: 228..270
AAA_17 [PF13207], Evalue: 7.30E-06, Aligned region: 629..666
AAA_17 [PF13207], Evalue: 7.30E-06, Aligned region: 792..832
AAA_19 [PF13245], Evalue: 7.30E-06, Aligned region: 228..250
AAA_19 [PF13245], Evalue: 7.30E-06, Aligned region: 628..652
AAA_29 [PF13555], Evalue: 2.70E-05, Aligned region: 218..244
AAA_29 [PF13555], Evalue: 2.70E-05, Aligned region: 628..656
Sigma54_activat [PF00158], Evalue: 4.70E-05, Aligned region: 224..246
Sigma54_activat [PF00158], Evalue: 4.70E-05, Aligned region: 630..753
NACHT [PF05729], Evalue: 4.80E-05, Aligned region: 228..255
NACHT [PF05729], Evalue: 4.80E-05, Aligned region: 630..655
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 228..325
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 629..711
AAA_14 [PF13173], Evalue: 0.00037, Aligned region: 842..868
AAA_25 [PF13481], Evalue: 0.00054, Aligned region: 223..304
AAA_25 [PF13481], Evalue: 0.00054, Aligned region: 627..648
Zeta_toxin [PF06414], Evalue: 0.00076, Aligned region: 228..248
Zeta_toxin [PF06414], Evalue: 0.00076, Aligned region: 629..670
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 228..248
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 631..659
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 208..248
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 281..319
Arch_ATPase [PF01637], Evalue: 0.004, Aligned region: 629..642
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 228..248
SRP54 [PF00448], Evalue: 0.0086, Aligned region: 629..663
DUF815 [PF05673], Evalue: 0.0096, Aligned region: 223..271
DUF815 [PF05673], Evalue: 0.0096, Aligned region: 584..668
Protein Sequence: 898 a.a.     [Download]
>gi|73541416|ref|YP_295936.1| unnamed protein product [Ralstonia eutropha JMP134]
MDIDIRTLLSRLNPECRQAMEAAAQLCVRHTHYNVDVEHLLVQLLEVEARDLHVILEHFGIARETLLAQL
HKAIDGFKRGNGRTPALSPNFSPLFQEAWLLSSMLLGEQQVRAGTLMLALLEVESLRGLLLESAPSLLKI
PRTALREALPVLLGAGAGGGAPADVAGRAMPAMPQASAGGAQKSALNQYTIDLTALAREGAIDPVRGRDG
EIRQLVDVLLRRRQNNPILTGEAGVGKTAVVEGFAQRIVAGDVPPALRNVSVRSLDLALLQAGAGVKGEF
ENRLKSVIAEVAASPVPVILFIDEAHQLIGAGGSEGQGDAANLLKPALARGELRTIAATTWAEYKKYIER
DPALARRFQIVKVEEPSEPVAVEMLRGMVKKLEAHHGVEILDDAVRDAVKLSHRYVSGRQLPDKAISVLD
TACARVAIAQNGVPAEIESLGRSIENTENQLRILRHEAATGASRADEIATATRQLEEARSQHARLSDKLV
MEKRVVDEILAWRRRIATCLAGQAGGEAGVDAQDSEDSDDSAESLSANLLRLEKGLEAVQCDEPMVPVCV
NSAAVAEVISSWTGIPVGRMLADELHTVLHLHDKLAERVVGQDEALDAIARRIRTFRADLDDPGKPVGVF
LLVGPSGVGKTETACALADLLYGGERNMITVNMSEFQEAHSVSGLKGAPPGYVGYGRGGVLTEAVRRRPY
SVVLLDEMEKAHPDVLELFFQVFDKGMMEDGEGVPIDFRNTVILLTSNAAQDVITEASQGGRRPPPEELV
ERLRPALLQRFSPAFLARMVLVPYYHLGDAQITAIVDLKLGRMAQRFERNHNARLTWDDALARTIVQRCS
EVDSGARNVDHILTQSVLPELAHQVLERMSIAEPFGGVHLSLDAQGGLAFRFLPPAEA
 
Nucleotide Sequence: 2697 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1867499-1864803 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGACATCGATATCCGCACACTGCTGAGCCGGCTTAATCCGGAATGCCGCCAGGCCATGGAGGCCGCGG
CGCAACTCTGCGTGCGCCACACCCACTACAACGTCGATGTCGAGCACCTGTTGGTGCAGCTGCTGGAGGT
CGAGGCGCGCGACCTGCACGTCATCCTCGAGCACTTCGGCATTGCGCGCGAGACGCTGCTGGCGCAGCTG
CACAAGGCCATCGACGGCTTCAAGCGCGGCAATGGCCGTACCCCGGCGCTGTCGCCCAACTTCTCGCCGC
TGTTCCAGGAGGCCTGGCTGCTCAGCTCGATGCTGCTGGGCGAGCAACAGGTGCGCGCCGGCACGCTGAT
GCTGGCGCTGCTTGAAGTGGAAAGCCTGCGCGGCCTGCTTCTGGAGTCGGCGCCGTCCCTGCTGAAGATT
CCACGCACGGCATTGCGCGAGGCGCTGCCCGTGCTGCTGGGCGCTGGCGCTGGCGGCGGCGCGCCGGCCG
ATGTAGCCGGGCGCGCCATGCCGGCAATGCCGCAGGCCAGCGCCGGCGGCGCACAGAAATCCGCGCTGAA
CCAATACACGATCGACCTGACGGCGCTGGCGCGCGAAGGCGCGATCGATCCGGTGCGCGGGCGCGACGGC
GAGATCCGCCAGCTTGTGGACGTACTGCTGCGCCGTCGCCAGAACAACCCCATCCTGACCGGCGAGGCCG
GCGTCGGCAAGACCGCCGTAGTGGAAGGCTTTGCCCAGCGCATCGTGGCCGGCGACGTGCCGCCGGCACT
GCGCAATGTCTCGGTGCGCTCGCTCGATCTGGCCTTGCTGCAGGCCGGCGCTGGCGTCAAGGGCGAGTTC
GAGAACCGGCTCAAGTCGGTAATTGCCGAGGTCGCGGCCTCGCCGGTACCGGTGATCCTGTTCATCGACG
AGGCCCACCAGCTGATCGGCGCGGGTGGCAGCGAAGGGCAGGGCGATGCCGCCAACCTGCTCAAGCCGGC
GCTGGCACGCGGCGAGCTGCGCACCATCGCCGCGACCACTTGGGCCGAGTACAAGAAGTACATCGAGCGC
GATCCAGCACTGGCGCGCCGCTTCCAGATCGTCAAGGTGGAGGAGCCCAGCGAGCCGGTGGCCGTGGAGA
TGCTGCGCGGCATGGTGAAGAAGCTCGAAGCGCACCATGGCGTGGAGATCCTCGACGATGCCGTGCGCGA
TGCGGTCAAGCTGTCGCACCGCTATGTGTCGGGACGCCAGTTGCCGGACAAGGCGATCAGCGTGCTCGAT
ACCGCTTGCGCGCGCGTGGCGATCGCGCAGAACGGCGTGCCGGCAGAGATCGAATCGCTCGGGCGCAGCA
TCGAAAACACCGAGAACCAGTTGCGCATTCTGCGGCATGAGGCGGCCACCGGTGCCAGCCGTGCCGACGA
GATTGCCACTGCCACGCGCCAGCTCGAGGAGGCACGCAGCCAGCATGCGCGCCTGTCCGACAAGCTGGTG
ATGGAAAAGCGCGTAGTCGACGAGATCCTGGCATGGCGGCGCAGGATTGCCACGTGCCTGGCCGGCCAGG
CGGGTGGCGAAGCGGGCGTGGATGCACAGGACAGCGAAGACAGCGACGACAGCGCGGAATCGCTGAGCGC
CAACCTGCTGCGGCTTGAAAAGGGCCTGGAGGCCGTGCAGTGCGACGAGCCAATGGTGCCGGTGTGCGTC
AATTCGGCAGCGGTGGCCGAGGTCATCTCGAGCTGGACTGGCATCCCGGTGGGCCGCATGCTGGCCGACG
AGCTTCACACCGTGCTTCACCTGCACGACAAGCTGGCCGAGCGGGTGGTCGGCCAGGACGAGGCGCTCGA
TGCGATCGCGCGGCGCATCCGAACCTTCCGCGCGGATCTCGACGACCCCGGCAAGCCGGTGGGCGTGTTC
CTGCTGGTCGGTCCGAGCGGCGTTGGCAAGACCGAGACCGCCTGCGCGCTGGCGGACTTGTTGTACGGTG
GCGAGCGCAACATGATCACCGTCAACATGTCGGAATTCCAGGAGGCGCACAGCGTGTCGGGGCTCAAGGG
CGCGCCCCCGGGCTATGTCGGCTACGGGCGCGGGGGCGTGCTGACCGAAGCGGTGCGGCGGCGCCCCTAT
AGCGTGGTGCTGCTCGACGAAATGGAGAAGGCGCACCCCGACGTGCTGGAGCTGTTCTTCCAGGTATTCG
ACAAGGGCATGATGGAAGACGGCGAAGGGGTACCGATCGACTTCCGCAACACGGTCATCCTGCTGACCTC
GAACGCGGCCCAGGACGTCATCACCGAGGCCTCGCAAGGCGGCCGGCGCCCGCCACCGGAAGAACTTGTA
GAACGCCTGCGTCCGGCCCTGCTGCAGCGCTTCAGCCCGGCCTTCCTGGCGCGCATGGTGCTGGTGCCGT
ACTACCACCTTGGCGATGCGCAGATCACCGCCATCGTCGACCTCAAGCTTGGCCGGATGGCGCAGCGCTT
CGAGCGCAACCACAACGCCCGCCTGACCTGGGACGACGCGCTGGCGCGCACCATCGTGCAGCGCTGCAGC
GAAGTCGACAGCGGCGCGCGCAACGTCGACCATATCCTGACCCAGTCGGTGCTGCCGGAGCTCGCCCATC
AGGTGCTGGAGCGCATGTCGATCGCCGAGCCGTTCGGCGGTGTGCATCTCTCGCTTGACGCGCAGGGCGG
CCTGGCCTTCCGTTTCCTGCCGCCTGCGGAGGCCTGA