SecReT6
Protein ID: 73541417
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1728
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1867512..1868576 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ470U0
KEGG IDreu:Reut_A1728
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-80, Aligned region: 18..332
Protein Sequence: 354 a.a.     [Download]
>gi|73541417|ref|YP_295937.1| unnamed protein product [Ralstonia eutropha JMP134]
MGADDRLPDAAVIDRLAANPAAFNLFQAIGLLERATPGAHPLGHGDGSGEAVRLRGLVSLAFQPRDVASV
VAGAPQDADHADNEPPREAGQPPYTLTTPALSLAGANGPLPLPYTELLLERRAARDHAMAELLDIFNHRF
LSFLYRGRVKHAPGLGAQAPATTTLAACLDALSNLGLRAGPRGPGGAAPWLRHAGLLGAAPRSMEGLLAL
LGDRLGLRVRGRQFVGGWLAVERTDSVRLGARGAPGTQLGGGAVLGRRCWDQSAGIGLDLQVPDARRLEG
LLPGGPDHDLVAWLVRSHASQPFDVQLALQVAERPATRLGGGARLGWTAWLAGGAAARPAPVRLSLRVGA
DTLS
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1868576-1867512 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGGAGCCGATGACCGGCTGCCAGACGCTGCTGTGATCGACCGTCTCGCCGCCAACCCCGCCGCGTTCA
ACCTGTTCCAGGCCATCGGCCTGCTGGAACGGGCCACGCCCGGTGCGCATCCGCTCGGCCACGGCGACGG
CAGCGGCGAGGCCGTACGCCTGCGCGGGCTGGTTTCGCTGGCCTTCCAGCCGCGCGATGTGGCATCGGTG
GTTGCCGGTGCGCCGCAAGATGCCGACCATGCCGACAACGAGCCGCCTCGTGAGGCCGGCCAGCCGCCCT
ACACGCTGACCACGCCGGCCCTGTCGCTGGCGGGGGCAAATGGGCCGCTGCCGCTGCCATACACCGAGCT
ACTGCTGGAGCGGCGCGCGGCGCGCGACCATGCCATGGCGGAGTTGCTCGACATCTTCAATCACCGCTTC
CTGTCCTTCCTCTATCGCGGTCGTGTCAAGCACGCGCCGGGGCTGGGCGCGCAGGCACCTGCCACCACGA
CGCTGGCCGCCTGCCTCGACGCGCTCAGCAACCTGGGCCTGCGTGCCGGCCCGCGCGGTCCGGGCGGCGC
TGCGCCCTGGCTGCGCCACGCCGGCCTGCTGGGCGCCGCGCCGCGCTCGATGGAAGGGCTGCTGGCCTTG
CTGGGCGACCGGCTCGGGCTGCGGGTGCGCGGCCGCCAGTTCGTCGGCGGCTGGCTGGCGGTGGAGCGCA
CCGACTCGGTCCGCCTGGGCGCGCGTGGCGCACCGGGGACGCAGCTCGGCGGAGGCGCGGTGCTGGGACG
GCGGTGCTGGGACCAGTCCGCCGGCATCGGCCTGGACCTGCAGGTGCCGGACGCGCGCCGGCTGGAGGGG
CTGCTGCCCGGTGGCCCCGATCACGACCTGGTTGCATGGCTGGTGCGCAGCCATGCGTCGCAACCCTTCG
ACGTGCAGCTCGCGCTGCAGGTTGCCGAGCGGCCGGCCACACGCCTGGGCGGCGGCGCCCGGTTGGGCTG
GACTGCGTGGCTGGCCGGTGGTGCTGCTGCACGTCCCGCACCGGTGCGGCTGTCGCTGCGTGTCGGCGCC
GACACGCTTTCATGA