SecReT6
Protein ID: 73541418
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1729
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1868540..1870300 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ470T9
KEGG IDreu:Reut_A1729
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-183, Aligned region: 10..586
Protein Sequence: 586 a.a.     [Download]
>gi|73541418|ref|YP_295938.1| unnamed protein product [Ralstonia eutropha JMP134]
MAELGEGDILHYYKRELSYLRTQGAAFAERYPMVASRLALHGTESLDPHTERLIEATAFLAARVHRDLDQ
SFPQVASSLLENVCPALVQPLPSMTVVQFALDPSQGKVTAGYRVPRHTGLQARTEDDQTCRFRTSWETTL
WPLTVEQAQFDQDHTLRLTLACADGVDFSELELTTLRLHLHGDWMVTMPLYELLVSGVAGVRIEPSDGEA
SLLPASAWREVGYDADEAVLPQPPNAQPAYGLMQEYFAFPRKFHFFDLALPAGRLGRGTRCDIVLRLARV
SRGMARIGAGNFRLGCVPAINLFSQTSEPIVLDQRHYEYRLVADQRREAATEIHSVSSVVLSDPASDRTQ
AVPPVAAASGDAGADGVYWWTRREPTLRPGLSGTDTYLTFVDAGKTSSQPAAPVAYANVLCTNRRLAEQV
PVGARMLVENVSQNARVRLLYEPTVQRNPPLGGESLWRLVSLLTLHHGTLASGATGRHEVQQMLRLFAAD
GSRELEQIRGIRSVQSRGVTAHIGGDAWRGFCRGTEIAIEFDADAFAGGSPLLMGAVLARFFALYTSVNS
FVRLVVRRGDEIWKQWEPMTGCQTLL
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1870300-1868540 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGCTGAGCTGGGCGAAGGCGACATCCTGCACTACTACAAGCGGGAGCTGTCCTATCTGCGTACGCAGG
GCGCGGCTTTCGCCGAACGCTATCCCATGGTGGCGTCGCGCCTGGCGCTGCACGGCACCGAATCGCTTGA
CCCGCATACCGAACGCCTGATCGAGGCGACGGCCTTCCTGGCCGCACGTGTGCACCGCGATCTCGACCAG
TCCTTTCCGCAGGTCGCTTCGTCGCTGCTGGAGAATGTCTGCCCGGCGCTGGTGCAACCGCTGCCCTCGA
TGACCGTGGTGCAGTTCGCGCTCGACCCGAGCCAGGGCAAGGTCACCGCAGGCTACCGGGTACCTCGCCA
TACCGGACTGCAGGCCCGTACCGAGGACGATCAGACCTGCCGCTTCCGCACCAGCTGGGAAACGACGCTG
TGGCCGCTGACGGTCGAGCAGGCCCAGTTCGACCAGGACCATACCCTGCGCCTGACGCTTGCCTGTGCCG
ACGGTGTCGACTTCTCGGAGCTGGAACTCACCACGCTGCGCCTGCACCTGCACGGCGACTGGATGGTGAC
GATGCCGCTTTACGAACTGCTGGTGAGCGGGGTGGCCGGCGTGCGCATCGAGCCGAGCGACGGCGAGGCC
TCGCTGCTGCCGGCTTCGGCCTGGCGCGAGGTCGGCTACGATGCCGACGAGGCCGTGCTGCCGCAGCCGC
CCAATGCGCAACCGGCTTATGGGTTGATGCAGGAGTACTTCGCCTTTCCGCGCAAGTTCCACTTCTTCGA
TCTGGCGTTGCCCGCGGGCCGGCTTGGGCGCGGCACGCGCTGCGATATCGTGCTGCGTCTGGCGCGAGTG
TCGCGCGGCATGGCGCGCATTGGCGCCGGCAATTTCCGCCTGGGCTGCGTGCCGGCCATCAACTTGTTCT
CGCAGACCAGTGAGCCGATCGTGCTCGACCAGCGTCACTACGAGTACCGGCTGGTGGCGGACCAGCGGCG
CGAGGCCGCCACCGAGATCCATTCGGTCAGCTCGGTGGTGCTGTCCGATCCGGCCAGCGATCGAACCCAG
GCTGTGCCACCAGTTGCCGCGGCCAGCGGCGACGCGGGTGCCGACGGCGTGTACTGGTGGACCCGCCGCG
AGCCGACCCTTCGGCCCGGCCTGTCCGGCACCGACACCTACCTGACCTTTGTCGATGCGGGCAAGACAAG
CAGCCAGCCGGCAGCGCCAGTCGCCTATGCCAACGTGCTTTGCACCAACCGGCGCCTGGCCGAGCAGGTC
CCGGTGGGCGCGCGCATGCTGGTGGAAAACGTTTCGCAGAACGCGCGCGTGCGTTTGCTGTACGAGCCGA
CGGTTCAGCGCAATCCGCCGCTGGGCGGCGAATCGCTGTGGCGGCTTGTGTCGTTGCTGACGCTGCATCA
CGGCACGCTGGCAAGCGGTGCCACCGGTCGCCACGAGGTGCAGCAGATGCTGCGCCTGTTCGCCGCCGAC
GGCAGCCGCGAATTGGAACAGATCCGTGGCATACGCAGCGTGCAATCGCGCGGTGTCACCGCACATATCG
GCGGGGATGCCTGGCGCGGCTTCTGCCGTGGCACCGAGATCGCCATCGAGTTCGATGCCGACGCCTTTGC
AGGGGGATCGCCGCTGTTGATGGGCGCCGTGCTGGCGCGCTTCTTTGCGTTGTACACCTCGGTCAATTCC
TTTGTGCGGCTGGTGGTGCGCCGCGGAGACGAGATATGGAAGCAATGGGAGCCGATGACCGGCTGCCAGA
CGCTGCTGTGA