SecReT6
Protein ID: 73541419
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1730
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1870293..1870757 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ470T8
KEGG IDreu:Reut_A1730
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-18, Aligned region: 31..135
Protein Sequence: 154 a.a.     [Download]
>gi|73541419|ref|YP_295939.1| unnamed protein product [Ralstonia eutropha JMP134]
MATIISGAPVPLFERLASGGTEPSAHLLDGAQLRQSVARELGRLLNTRSRLCAEAFLASEGTVLDYGVPD
CSSRSLQSGPDRALIAALVRHAVTLFEPRLRNVNVQFSTSLNTALAQPVLLIDGELCLGQAPERVSFELA
AGDETAQLRGADHG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1870757-1870293 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGCGACGATCATCAGCGGCGCACCCGTGCCCCTGTTCGAACGGCTGGCGTCCGGCGGCACCGAGCCGT
CGGCGCACCTGCTCGACGGGGCGCAGTTGCGCCAATCGGTGGCGCGCGAACTGGGACGCCTGCTCAATAC
GCGCTCGCGCCTGTGCGCCGAGGCTTTCCTCGCCAGCGAGGGCACGGTGCTTGATTACGGCGTGCCCGAC
TGCTCTTCGCGTTCCCTGCAGTCCGGCCCGGACCGCGCGCTGATTGCCGCGCTGGTGCGGCATGCCGTGA
CTTTGTTCGAGCCGCGGCTGCGCAACGTGAACGTGCAATTCAGTACCTCTTTGAACACCGCATTGGCGCA
GCCGGTCCTGCTGATCGACGGTGAGCTTTGTCTTGGCCAGGCGCCCGAGCGGGTTTCGTTCGAACTGGCC
GCAGGCGACGAGACGGCCCAACTGCGCGGGGCCGATCATGGCTGA