SecReT6
Protein ID: 73541420
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1731
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1870799..1871281 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ470T7
KEGG IDreu:Reut_A1731
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-33, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|73541420|ref|YP_295940.1| unnamed protein product [Ralstonia eutropha JMP134]
MDTIILEITDIKGNTKITGHEDKIQIMSFSNGVSMHMNRDVSNSERTMGRPDFQNITLSKMTDQATPGLY
GACAGGKDLGVVKLLMGRNEGDTFMPLMTYTLKNTMVSNISTGGGGSEAMDTFCLDFTEIKVEYTKQGSD
SKKQGTAAFGWDLATNKAVS
 
Nucleotide Sequence: 483 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1871281-1870799 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGACACCATCATCCTCGAGATCACTGATATCAAGGGCAACACCAAGATCACCGGCCATGAAGACAAGA
TCCAGATCATGTCTTTCAGCAATGGTGTATCGATGCACATGAACCGGGATGTCTCGAATTCCGAGCGCAC
CATGGGTCGCCCGGACTTCCAGAACATCACCCTCAGCAAGATGACCGACCAGGCCACCCCGGGCCTGTAC
GGCGCCTGCGCCGGCGGCAAGGACCTTGGCGTGGTCAAGCTGCTGATGGGTCGCAACGAGGGCGACACGT
TCATGCCGCTGATGACCTACACGCTGAAGAACACCATGGTCAGCAACATCAGCACCGGCGGTGGCGGCAG
CGAAGCGATGGACACGTTCTGTCTGGATTTCACCGAGATCAAGGTCGAATACACCAAGCAGGGTTCGGAC
TCGAAGAAGCAGGGCACGGCCGCTTTCGGCTGGGACCTGGCTACCAACAAGGCCGTTTCCTGA