SecReT6
Protein ID: 73541421
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1732
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1871383..1872885 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ470T6
KEGG IDreu:Reut_A1732
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-179, Aligned region: 73..496
Protein Sequence: 500 a.a.     [Download]
>gi|73541421|ref|YP_295941.1| unnamed protein product [Ralstonia eutropha JMP134]
MASNPIAEAATESKAAAAAATELTLLERIVQEGNMAVEPSQSVYAKKLIGQLASQILDEGMRTSPDKSLV
ATINERVAEIDQLISDQLNAIMHDADFQALEASWTGLHDMVYGTETGQNLKLRLLNVSKRDLLKDLESAV
DHDMSVLFKKVYEEEYGTFGGYPYTVLIGDYSFGRHPQDLALLERVSKVAAAAHAPFIASAAPSLFDLKT
FTDLGVARDLSKIFESAELAAWRSFRESEDSRYVSLVLPSYAARLPYGAKTNPVENFNFEEDVDGTDHGK
YLWANSAYQLGLRITGAFSRYGWATAIRGVEGGGKVDGMVAHAYKTDEGDVVLKCPTEVTITDRREKELN
DLGFIAIVNAKGSNSATFFGSQTANKPKIYNKDSANANAQLSARLPYVLAASRFAHYLKVIMRDKVGSFQ
NRTDVENFLNNWIADYVLINPSASQEAKARFPLSEARVDVTEVPGKPGAYRATCFLKPHFQMEELTASMR
LVAELPAAAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1872885-1871383 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGGCAAGCAATCCTATCGCCGAAGCGGCGACCGAATCGAAGGCGGCCGCCGCCGCCGCAACCGAACTGA
CCCTGCTCGAGCGCATCGTGCAGGAAGGCAACATGGCCGTGGAGCCGTCGCAGAGCGTCTACGCGAAGAA
GCTGATCGGCCAGCTGGCCTCGCAGATTCTCGACGAAGGCATGCGCACCAGCCCCGACAAGAGCCTGGTG
GCAACCATCAACGAGCGCGTGGCCGAGATCGACCAGTTGATCTCCGACCAGCTCAACGCGATCATGCACG
ACGCGGACTTCCAGGCGCTGGAAGCGTCGTGGACCGGCCTGCATGACATGGTGTACGGCACCGAGACCGG
CCAGAACCTGAAGCTGCGCCTGCTCAACGTCAGCAAGCGTGACCTGCTGAAGGACCTGGAGTCGGCGGTC
GACCACGACATGAGCGTGCTGTTCAAGAAGGTCTACGAAGAGGAGTACGGCACCTTCGGCGGCTATCCCT
ACACCGTGCTGATCGGCGACTACAGCTTTGGCCGCCATCCGCAGGACCTGGCGCTGCTGGAGCGCGTGTC
GAAGGTGGCCGCAGCCGCCCACGCGCCGTTCATTGCCTCGGCCGCGCCGAGCCTGTTCGACCTCAAGACG
TTCACCGACCTGGGTGTGGCGCGCGACCTTTCGAAGATCTTCGAGAGCGCCGAGCTGGCAGCCTGGCGCT
CCTTCCGCGAGTCGGAGGATTCGCGCTATGTGTCACTGGTGCTGCCGTCCTACGCGGCACGCCTGCCGTA
CGGCGCCAAGACTAACCCCGTCGAGAACTTCAACTTCGAGGAAGATGTCGACGGCACCGATCACGGCAAG
TACCTGTGGGCCAACTCGGCCTACCAGCTCGGTCTGCGCATCACCGGCGCCTTCTCGCGCTACGGCTGGG
CTACCGCGATCCGCGGCGTGGAAGGCGGCGGCAAGGTGGACGGCATGGTTGCCCACGCCTACAAGACTGA
CGAAGGCGACGTGGTGCTCAAGTGCCCGACCGAGGTGACCATCACCGACCGTCGCGAGAAGGAGCTGAAC
GACCTCGGCTTCATCGCCATCGTCAACGCCAAGGGCTCCAACAGCGCCACCTTCTTCGGCAGCCAGACCG
CCAACAAGCCCAAGATCTACAACAAGGACTCGGCCAACGCCAACGCGCAGCTGTCGGCTCGCCTGCCTTA
CGTGCTGGCGGCATCGCGCTTCGCGCATTACCTGAAGGTGATCATGCGCGACAAGGTGGGTAGCTTCCAG
AACCGCACCGACGTGGAGAACTTCCTCAACAACTGGATCGCGGATTACGTGCTGATCAACCCGTCGGCAT
CGCAGGAAGCCAAGGCGCGGTTCCCGCTCAGCGAGGCACGCGTGGATGTGACGGAAGTGCCGGGCAAGCC
GGGCGCCTATCGTGCGACCTGCTTCCTGAAGCCGCACTTCCAGATGGAAGAGCTGACCGCATCGATGCGC
CTGGTGGCCGAATTGCCGGCCGCAGCCGCCTGA