SecReT6
Protein ID: 73541422
SecReT6 ID88
T6SS typei4a
Gene symbol-
Locus tagReut_A1733
StrainRalstonia eutropha JMP134
Repliconchromosome I [GenBank: NC_007347] [Browse all T6SS(s) in this replicon]
Location [Strand]1872929..1873477 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ470T5
KEGG IDreu:Reut_A1733
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-56, Aligned region: 10..163
Protein Sequence: 182 a.a.     [Download]
>gi|73541422|ref|YP_295942.1| unnamed protein product [Ralstonia eutropha JMP134]
MSNSLQKWVGRNRPPRVQISYDVEVGDAIEKRELPMVVGLLADLSGHPAEPLPKLKERRFVEIDRDNFDE
IMGKIAPRLELSVPDTMKDGQSNLKVELNFEKFSDFHPESLVGQIPRLAKLLEARQQLRDLLGKLDGNDE
LDSLLERIVRDADELKKVRSEADAGQPAAADEQAAETPADAS
 
Nucleotide Sequence: 549 bp     [Download]
>gi|73539706|ref|NC_007347.1|:c1873477-1872929 Ralstonia eutropha JMP134 chromosome 1, complete sequence
ATGTCCAATAGCCTGCAGAAGTGGGTCGGGCGCAATCGCCCGCCCCGTGTCCAGATCTCGTACGACGTCG
AAGTGGGTGACGCCATCGAGAAGCGTGAATTGCCCATGGTGGTCGGCCTTCTGGCGGACCTGTCGGGCCA
TCCCGCCGAGCCGCTGCCCAAGCTGAAGGAGCGCCGCTTCGTCGAGATCGACCGCGACAACTTCGACGAG
ATCATGGGCAAGATCGCGCCGCGCCTGGAGCTGTCGGTTCCCGACACCATGAAGGACGGCCAGTCCAACC
TGAAGGTCGAACTGAACTTCGAGAAATTCAGCGACTTCCATCCGGAAAGCCTGGTGGGTCAGATTCCGCG
CCTGGCCAAGCTGCTCGAGGCGCGCCAGCAACTGCGCGACCTGCTGGGCAAGCTCGACGGCAACGACGAG
CTCGACTCGCTGCTCGAGCGCATCGTGCGCGATGCCGATGAGCTGAAGAAGGTGCGCAGCGAAGCCGACG
CCGGCCAGCCGGCCGCAGCGGACGAGCAAGCCGCAGAAACGCCGGCCGACGCCAGCTAA