SecReT6
Protein ID: 74310842
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0242
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]265070..267529 [-]
ProductATP-dependent Clp proteinase ATP-binding chain
NoteTssH
UniProt IDQ3Z5D6
KEGG IDssn:SSON_0242
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 118..136
AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 542..703
AAA [PF00004], Evalue: 6.40E-17, Aligned region: 117..228
AAA [PF00004], Evalue: 6.40E-17, Aligned region: 548..665
AAA [PF00004], Evalue: 6.40E-17, Aligned region: 713..739
AAA_5 [PF07728], Evalue: 6.20E-14, Aligned region: 116..136
AAA_5 [PF07728], Evalue: 6.20E-14, Aligned region: 547..667
ClpB_D2-small [PF10431], Evalue: 2.90E-13, Aligned region: 709..785
AAA_16 [PF13191], Evalue: 5.90E-12, Aligned region: 93..133
AAA_16 [PF13191], Evalue: 5.90E-12, Aligned region: 159..194
AAA_16 [PF13191], Evalue: 5.90E-12, Aligned region: 316..393
AAA_16 [PF13191], Evalue: 5.90E-12, Aligned region: 518..588
AAA_16 [PF13191], Evalue: 5.90E-12, Aligned region: 613..641
AAA_22 [PF13401], Evalue: 3.70E-08, Aligned region: 115..201
AAA_22 [PF13401], Evalue: 3.70E-08, Aligned region: 341..376
AAA_22 [PF13401], Evalue: 3.70E-08, Aligned region: 546..581
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 116..140
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 350..381
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 542..576
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 609..630
AAA_25 [PF13481], Evalue: 5.90E-05, Aligned region: 710..739
AAA_29 [PF13555], Evalue: 6.10E-05, Aligned region: 60..75
AAA_29 [PF13555], Evalue: 6.10E-05, Aligned region: 108..134
AAA_29 [PF13555], Evalue: 6.10E-05, Aligned region: 545..572
AAA_14 [PF13173], Evalue: 6.40E-05, Aligned region: 116..217
AAA_14 [PF13173], Evalue: 6.40E-05, Aligned region: 547..637
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 116..143
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 177..239
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 347..347
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 548..576
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 113..137
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 541..569
DUF258 [PF03193], Evalue: 0.00022, Aligned region: 92..133
DUF258 [PF03193], Evalue: 0.00022, Aligned region: 548..566
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 117..136
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 548..583
AAA_17 [PF13207], Evalue: 0.0068, Aligned region: 116..157
AAA_17 [PF13207], Evalue: 0.0068, Aligned region: 548..582
IstB_IS21 [PF01695], Evalue: 0.0073, Aligned region: 110..138
IstB_IS21 [PF01695], Evalue: 0.0073, Aligned region: 547..558
Zeta_toxin [PF06414], Evalue: 0.0083, Aligned region: 116..135
Zeta_toxin [PF06414], Evalue: 0.0083, Aligned region: 546..587
Protein Sequence: 819 a.a.     [Download]
>gi|74310842|ref|YP_309261.1| ATP-dependent Clp proteinase ATP-binding chain [Shigella sonnei Ss046]
MQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDAS
DTLLARYAKNMTADARNGRLDPVLCRDHEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQ
VPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISN
LLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDD
DALQAAATLSERYLSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLERELRIGL
RTDTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESE
SESESEQDNTGAEPADEADREQPEETAETVSPVQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWT
GVPLNRLSQNEMSVITDLTKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTET
VLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHP
DVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQEVQYPVLADFFKPALLAR
MEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGVEVVIEPEVTDEIMSRVTRAENGARMLESVIDGDML
PPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDAQNDESVTKDETVL
 
Nucleotide Sequence: 2460 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c267529-265070 Shigella sonnei Ss046 chromosome, complete genome
ATGCAGCACAGCGAACTGCGCGGCGGCGTGTTGCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATAC
CGCCTGCTGCCGCCCGGCTGTTGACCGGCATTAACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGAC
ACAGGAGTCGGCGGAATCAGTCGTGCCGGATGCAGACGGTAAAGGCGCAGGCACAATGACGGACGCCTCT
GACACCCTGCTTGCCCGCTATGCCAAAAACATGACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTAC
TGTGCCGCGACCACGAAATCGACCTGATGATCGACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGT
GGTGGGCGAAGCGGGCGTGGGCAAAAGCGCACTGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAG
GTGCCGGACAAGCTGAAAAACACCGATATCATGACCCTTGACTTGGGCGCATTGCAGGCCGGGGCGTCGG
TGAAGGGTGAATTCGAAAAACGTTTCAAAGGGCTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCAT
TCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAAC
CTGCTCAAACCGGCGCTGGCGCGCGGCGAGCTGAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAA
AATACTTCGAAAAAGATGCCGCCCTGTCGCGCCGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGC
CGAAGCCACCATTATTCTGCGCGGTCTGTCGGCGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGAT
GACGCCTTGCAGGCCGCTGCGACATTAAGCGAGCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGA
TTGATGTGCTGGATACCGCCTGCGCCCGTGTGGCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGC
GCTGACCACTCTGAGCCACCAGCAGGAGGCGGAAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTG
CGTACCGACACATCACGGATGACCGAGGTGCTGGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAAC
TGGAAGCGGCCTGGCACCAGCAGCAGACGCTGGTCCGGGAGATTATCGCGCTGCGCCAGCAGTTACTGGG
CGTGGCAGAGGACGATGCGGCGCCGTTGCCGGACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAG
TCAGAGTCAGAGTCAGAGCAGGATAATACCGGTGCCGAACCGGCTGATGAGGCCGACAGAGAACAACCGG
AAGAGACCGCTGAAACAGTTTCCCCGGTACAGCGGCTGGCCCAGCTCACTGCCGAACTGGACGCCCTGCA
TAACGACCGGTTGCTGGTCTCCCCGCACGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACC
GGCGTGCCGCTCAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGACCTGACGAAATGGCTGGGTG
ACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCATAAGCATCTACTGACCGCACGCGCCGACCT
GCGTCGTCCGGGACGCCCGCTCGGTGCGTTCCTGCTGGCTGGCCCCAGCGGTGTGGGTAAAACCGAAACC
GTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAATTCC
AGGAGAAACACACCGTCTCGCGGCTGATTGGTTCGCCTCCGGGCTACGTTGGCTACGGTGAAGGCGGCGT
ACTGACCGAAGCGATTCGCCAGAAACCCTACTCGGTAGTACTGCTCGATGAAGTGGAAAAAGCGCACCCG
GATGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGGCGAAATGGCAGACGGTGAAGGCCGCCTGATTG
ACTGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTCGGCTACCAGGTAATAGTCGAGCATGCCGATGA
CCCGGAAACCATGCAGGAAGTACAGTATCCGGTGCTGGCCGACTTCTTCAAACCTGCCCTGCTGGCGCGT
ATGGAAGTGGTGCCGTATCTGCCGCTGTCGAAAGAGACGCTCGCCACCATTATCGCCGGAAAACTGGCCC
GTCTGGATAACGTGCTGCGCAGTCGCTTTGGTGTAGAAGTGGTCATTGAACCGGAAGTGACGGACGAAAT
CATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTCATCGATGGCGACATGCTA
CCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCTAACACGGCGATTGCCCGGATTCGGTTGTCGG
CAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCTCAGAACGACGAGTCCGTCACAAAGGATGAAAC
GGTTTTATGA