SecReT6
Protein ID: 74310845
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0245
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]268622..269410 [-]
Productcytoplasmic protein
NoteTssK
UniProt IDQ3Z5D3
KEGG IDssn:SSON_0245
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-95, Aligned region: 1..261
Protein Sequence: 262 a.a.     [Download]
>gi|74310845|ref|YP_309264.1| cytoplasmic protein [Shigella sonnei Ss046]
MDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHH
ARRSQLHPEDFYLDLAGLLGELMTFTEPSRLPCPLDVYDHHDLTKIFKTLLPEVKRALHTVLSPRAVNLP
LHLRDGIWQADIHDTELLQSATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMV
APRQLPYHSGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 789 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c269410-268622 Shigella sonnei Ss046 chromosome, complete genome
TTGGATGACGATTTTATCCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAG
AGGTACAGGGGGCCATTGGCGGACGGGCAAGCGATCTGGCAAACCGTATTGGCTCTCCGGCGCAGAGCGG
CATCGCGGATGTGGCGGAATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCAC
GCCCGTCGATCCCAGCTCCACCCGGAAGATTTCTACCTTGATCTTGCCGGGTTGCTGGGTGAACTGATGA
CCTTTACCGAGCCGTCGCGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAATATT
TAAAACGCTGTTACCGGAAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCCGTCAATCTGCCG
CTGCATCTGCGTGACGGTATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTG
TGCTGGCCGTGGCGGCAAACATGCCGGTCGATCAGATCCAGCGCCAGTTTATCCAGCAGTCGAAAATTTC
CTCGCCGGAAAAAATCCGCAATATGGTCAGTGTGCAGATCCCCGGTATTCCATTGCGTGCCCTTATGGTG
GCTCCCCGCCAGCTTCCTTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGTGGCCAGGCCTGGA
CAGAAATGGCTGCCGCCGGGGCCGTTGCACTGCATGTTTCCGGCAGTTTCCCGGATCTGAACATGCAACT
GTGGGCGATAAGAGGGTAA