SecReT6
Protein ID: 74310846
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0246
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]269403..269912 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ3Z5D2
KEGG IDssn:SSON_0246
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-44, Aligned region: 7..162
Protein Sequence: 169 a.a.     [Download]
>gi|74310846|ref|YP_309265.1| hypothetical protein SSON_0246 [Shigella sonnei Ss046]
MLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWGFTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDA
LPDPLHPQNFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRI
MSGAEDMSAYITLPLCRISDRRRWLPDVG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c269912-269403 Shigella sonnei Ss046 chromosome, complete genome
ATGCTGATGCGTCCACACCATTTCCAGCAGCAGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCC
GGGCCATGAATGATTTATCCTGGGGATTTACCGAACTCACCCTCAACAATGAACTGCTGGCGCAGGGTAA
GATCATGATTGACAGCGCGTCAGGCACACTGCCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCA
CTGCCCGATCCGCTGCACCCGCAAAATTTTCCGGACGAAAGAAGCCGCAATATCTACCTCGCTCTGCCGG
TCGCCAGTGATGTGAGAAATGAAATCAGCGACGGACGGCGAATCGGGCGTTACCGGCTGAATTATGCCGA
TGTCCGGGATTTGCATTCAGAAGAAGGTGACGCGCGAACATTGACGCTGGGTCAACTGACGCCGCGCATT
ATGAGCGGTGCAGAAGATATGAGCGCCTATATTACGCTCCCGCTTTGCCGTATCAGCGATCGCCGCCGAT
GGCTCCCTGACGTTGGATGA