SecReT6
Protein ID: 74310847
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0247
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]269954..270478 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ3Z5D1
KEGG IDssn:SSON_0247
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.30E-32, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|74310847|ref|YP_309266.1| lipoprotein [Shigella sonnei Ss046]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGIGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c270478-269954 Shigella sonnei Ss046 chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGTGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACCGAACCGGACACCAATACCAATGCGGAAGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCTGGCAGCCGACTATGACCAGATAGCCAGCACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGGTAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAATCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA