SecReT6
Protein ID: 74310849
SecReT6 ID90
T6SS typei1
Gene symbol-
Locus tagSSON_0249
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]271780..272862 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ3Z5C9
KEGG IDssn:SSON_0249
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.90E-92, Aligned region: 33..347
Protein Sequence: 360 a.a.     [Download]
>gi|74310849|ref|YP_309268.1| hypothetical protein SSON_0249 [Shigella sonnei Ss046]
MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELSLRDDPAQETL
RFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLAHLAWKAVHEQSPVGDFLDMFSH
RLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEII
CGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSI
TSLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTPEE
RPSVTIRVRS
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|74310614|ref|NC_007384.1|:c272862-271780 Shigella sonnei Ss046 chromosome, complete genome
ATGGACGGAAAGAATCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCCCGGCAGATAAAGAGCAGA
ATGATCCGCTGGCACAGGTTTTCCATAATGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCTGTTGCA
CCGCCTGGCAAAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGCGACGATCCGGCACAGGAAACCCTG
CGTTTCAGCGCCGATGCCAGCCTTGCCTTCCCGTGCAGTGATATCAGTGCGCTGAAACGGGATACGTCAG
GGGCATTCAGGATGACCACCACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTATTACCT
CGCTCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTCAGCCAC
CGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACGGCGGTG
TGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAAGCTGGC
GATTAATCACAGCAAAATGCTGGCGTATTCCGGGATCCTGGCAAATCCGGGACGATCCCCGGAAATTATC
TGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACACTGCAAAACTGGCAACGTCGCAAGGTGG
ATATTGAACCGGATCAGCAAAATAGTCTGGGGAGCTATTCTCTTAAAAATGGCGAAAAACTGGCGGGAAG
ATCGGTACTGGGCAACTTTGTTCTGGGTACACGAGTGCCCGATCTCAGCGGAAAATTCCAGCTCAGTATT
ACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGACGATGT
TCGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCAGGTGGG
CGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCGGAAGAA
CGACCCTCAGTCACCATCAGGGTACGGTCGTAA