SecReT6
Protein ID: 74310856
SecReT6 ID90
T6SS typei1
Gene symbolvgrG
Locus tagSSON_0256
StrainShigella sonnei Ss046
Repliconchromosome [GenBank: NC_007384] [Browse all T6SS(s) in this replicon]
Location [Strand]278810..280951 [+]
ProductRhs element protein
NoteTssI
UniProt IDQ3Z5C2
KEGG IDssn:SSON_0256
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.10E-63, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 4.40E-27, Aligned region: 366..458
Protein Sequence: 713 a.a.     [Download]
>gi|74310856|ref|YP_309275.1| Rhs element protein [Shigella sonnei Ss046]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLELSLVSQQFLSLEFPQVLDKMAYLTIWQGDDVQR
RVKGVVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESILATILKENGVTEWSPLFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTFC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRSGSGTTLNNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHVQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVNQIQTVGVNLVETVGSNQIIK
VGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMK
ENTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVP
KDLPPGMPDMRQF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|74310614|ref|NC_007384.1|:278810-280951 Shigella sonnei Ss046 chromosome, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTCTTTTCCCTCGAGCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTTCCGCAGGTACTGGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTGTGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGATGCTGTACAGCATGA
AGGTATGCCCACCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGA
AAGCATCCTCGCGACGATCCTGAAGGAAAACGGTGTGACCGAGTGGAGTCCGCTGTTCAGCGAGCCGCAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGCGAAACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGACACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAACCCGAACACCCGTACCGAGGTAAGTACCTTCTGC
ATCAGCCAGTTCCGCTACAGCGCACAAATCCGTCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GACCCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTACCCCGGACGTTTCAAGGGTGCTCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGG
CGCAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCTCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCAAGTGAACTGCACGGCGAGCA
GCCGCAGGCGGTGCCGGGACGCAGTGGTTCAGGAACCACGCTGAATAACCACTTTGCGGTAATACCGGCA
GACCGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGATGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGACAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGATTCGGT
AACCTTGCGATACCGCGCGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TTATTATGGGGCGTACCTACCACCAGGAAAACCGCACACCCGGTAGCCTGCCGGGGACGAAGACGCAGAT
GACCATTCGTTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGTGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACGGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCAGAACAT
TGGCGTTAATCAGATACAGACGGTTGGTGTCAACCTGGTGGAAACGGTGGGCAGTAACCAGATTATCAAA
GTGGGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCTTACCAGACGA
CGGTAGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTGCATAAATCACT
GATGGTGGGAATGGGCTACAGCGTCAATGTAGGGAATAACGTCACCTTCTCGGTGGGCAAGACGATGAAG
GAAAACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGC
TGGTGCTGACGAAGGACGGAAGCATATTTCTCAACGGTACGCACATTCATCTGGAAGGGGAGTCGGATGT
GAACGGTGATGCGCCAGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCG
AAAGATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA