SecReT6
Protein ID: 76817264
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1694
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2067895..2069487 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ3JHV2
KEGG IDbpm:BURPS1710b_A1694
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-191, Aligned region: 98..524
Protein Sequence: 530 a.a.     [Download]
>gi|76817264|ref|YP_336851.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MRAARRTRPTRRTTTAMRPERPPYTIPGKRTMKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREA
VEYAVRTLAEQALAQSATISDDAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTET
DERLKIRFMDISKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLG
SISKVAASAHTPFLSGASPSVLQMESWQELANPRDLTKIFTQNLEYASWNALRNMDDARYIGLAMPRFLS
RLPYGVLTNPVDEFDFEEDTNGADHRRYAWTNAAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHT
FPTDDGGIDIKCPTEIAISDRREAELSKNGFIPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSA
RLPYLFACSRFAHYLKCIVRDKVGAFKEREDMQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQ
AQGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSIKEAA
 
Nucleotide Sequence: 1593 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2069487-2067895 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAACCACGACAGCGATGCGGCCTGAGCGGCCGCCCT
ACACCATACCGGGGAAACGAACCATGAAGAAACAGCAAGCCCAGACGGCCGCCGCCGGCGTCCAGCCGCA
AGCGGATTCGGATTTCGCGCAGTTGCTCGCGCAGGAGTTCAAGCCGAAGACGGAGCAGGCGCGCGAAGCG
GTCGAATACGCGGTGCGCACGCTCGCCGAGCAGGCGCTCGCGCAATCGGCGACGATCAGCGACGATGCAT
ACAAGAGCATCGCCGCGATCATCGCGCAGATCGACCATAAGCTATCCGAACAGATCAACCTGATCCTCCA
TCACGCGGATTTCCAGAAGCTCGAATCGGCGTGGCGCGGGCTGCATCACCTGGTGTCGAACACCGAGACC
GACGAGCGCCTGAAGATCCGCTTCATGGACATCTCGAAGGAAGAGCTGCGCCGCACGATGCGGCGCTACA
AGGGGCAATCGTGGGACCAGAGCCCGCTCTTCAAGCAGATCTACGAGGAGGAGTACGGGCAGCTCGGCGG
CGAGCCGTACGGCTGCCTCGTCGCCGATTACTACTTCGACCACACGCCGCCCGACGTCGACCTGCTCGGC
TCGATCTCGAAGGTGGCCGCGTCCGCGCACACGCCGTTCCTCTCCGGCGCGTCGCCTTCGGTGCTGCAGA
TGGAATCGTGGCAGGAGCTCGCGAACCCGCGCGACCTGACGAAGATCTTCACGCAAAACCTCGAATACGC
GTCATGGAACGCGCTGCGCAACATGGACGACGCGCGCTACATCGGCCTCGCGATGCCGCGCTTCCTGTCG
CGCCTGCCGTACGGCGTGCTGACGAATCCCGTCGACGAGTTCGACTTCGAGGAAGACACGAACGGCGCCG
ACCATCGCCGCTATGCGTGGACGAACGCCGCCTACGCGATGGGCGTGAACATCAACCGGTCGTTCCGGCT
CTACGGCTGGTGCTCGCTCATTCGCGGCGTCGAATCGGGCGGCACGGTCGAGAACCTGCCGTGCCATACG
TTCCCGACCGACGACGGCGGCATCGACATCAAATGCCCAACCGAGATCGCGATCTCGGACCGGCGCGAGG
CGGAGCTGTCGAAGAACGGCTTCATTCCGCTCGTGCACCGCAAGAACACCGATCACGCGACGTTCATCGG
CGCGCAATCGCTGCACAAGCCGGCCGAATACGACGATTCCGACGCGACGGCCAACGCGAATCTGTCGGCG
CGCCTGCCGTATCTGTTCGCATGCTCGCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTGG
GCGCCTTCAAGGAGCGCGAGGACATGCAGCGCTGGCTGAACGAATGGATCATGAACTACGTCGACGCGGA
CCCGGCGAACTCGTCGCAGGACACGAAGGCGCGCCGGCCGCTCGCGGCCGCCGAGGTGGTCGTCGAGCAG
GCGCAGGGCAACCCCGGCTACTACCAGGCGAAGTTCTTCCTGCGGCCGCATTTCCAGCTCGAGGGCCTGA
CCGTGTCGCTGCGGCTCGTCGCGAAGCTGCCGTCGATCAAGGAAGCCGCCTGA