SecReT6
Protein ID: 76817325
SecReT6 ID94
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1603
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1953449..1954126 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ3JI43
KEGG IDbpm:BURPS1710b_A1603
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-28, Aligned region: 4..201
Protein Sequence: 225 a.a.     [Download]
>gi|76817325|ref|YP_336760.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRGGIANELGLAQCVFLDE
ITMRNLSTEQKEEWLRELLQFRFHSIRDGLSKVRARIDRLCRGHSANAALLEMYSLFHEFDLLGDKQGHA
LADARVSEARPTPGKKAVETAEVWKDGGAANEAAHGRSWRIVSGLLAFAALMTMWLVIDTRLSHEVEQME
VTSGDEAAIHPASGD
 
Nucleotide Sequence: 678 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1953449-1954126 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCCCGCGCAGCCGCTGCGCATGTTATTGCAGGACACGATGCTCCATGTCGCGCTATTGACGCAAGGCG
CGCGCATATCGCGCGTGCATGACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATTCGAGCAGGCGCT
GCAGGACGGCGGCTACCGCGGCGGTATTGCCAATGAATTGGGCCTCGCGCAATGCGTTTTTCTGGACGAG
ATCACGATGCGCAATCTGTCGACCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTCAGTTCCGTTTCC
ACTCGATTCGGGATGGGTTGAGCAAAGTGCGTGCGCGTATCGATCGCCTTTGCCGCGGGCATTCGGCGAA
TGCCGCATTGCTGGAAATGTACTCGTTGTTCCATGAATTCGATCTCCTGGGAGACAAGCAAGGACACGCG
TTAGCCGACGCGCGGGTGTCGGAGGCAAGGCCGACGCCCGGAAAGAAAGCCGTGGAAACGGCGGAGGTTT
GGAAAGACGGGGGGGCCGCCAATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCAGCGGCCTGCTGGC
GTTTGCGGCGCTCATGACGATGTGGCTCGTTATCGATACACGTCTGAGCCATGAAGTGGAACAGATGGAA
GTCACGTCCGGAGATGAAGCAGCGATTCATCCGGCATCGGGGGATTGA