SecReT6
Protein ID: 76817452
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1205
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1516466..1517782 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ3JJ90
KEGG IDbpm:BURPS1710b_A1205
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 49..253
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 335..363
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 376..417
OmpA [PF00691], Evalue: 1.70E-14, Aligned region: 250..259
OmpA [PF00691], Evalue: 1.70E-14, Aligned region: 318..416
Protein Sequence: 438 a.a.     [Download]
>gi|76817452|ref|YP_336363.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MNTSSDSFSAGSGGFVPPNPGGAHPAAAPAAGAAAFQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVH
HPNPAWLREHLVVEIRQFEERAQQAGVASEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNET
WGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPA
LSPHWRDVVTRDVTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAPPAPH
PAPAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADALNRVQGNVRV
SGYTDDTPVHTARFASNWDLSRERAQAVRSLIAARLDRPERITAEGRGTLDPVAPNDSPANRARNRRVEI
TLMLAPGSDAARATKEAP
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1517782-1516466 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAACACTTCTTCCGATTCGTTCTCGGCCGGCTCGGGCGGATTCGTGCCGCCGAATCCGGGCGGCGCGC
ACCCGGCCGCCGCGCCGGCGGCGGGTGCGGCCGCGTTTCAGCCGAGGCCGGGCCGCTGGGCGGCGAGCGG
CACGAATCCGCTCGTCGCGGCCGCGAACCCGCTGCTGAACCTCGTGCCGCAGATCCGTTCGACCGTCCAT
CATCCGAATCCCGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGAGCGCGCGCAGC
AGGCGGGCGTCGCCTCCGAGGCGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCCGC
CGCGCTGACGCCGTGGGGCGGCAGCGTATGGTCGTCGCATAGCCTGCTCGTGTCGTTCCACAACGAGACG
TGGGGCGGCGAGAAGTTCTTCCATCTGCTTGAGCGGCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGC
TCGAGCTGCTGTACTTCTGCCTCGCGCTCGGCTTCGAGGGGCGCTACCGCGTGCTCGACAACGGCCGCGC
GCAGCTCGACGCGGTGCGCCGCCAGCTCGCGCAGACGATCCGCTCGGTGCGCGGCGAATTCGATCCGGCG
CTCTCGCCGCATTGGCGCGACGTCGTCACGCGCGACGTCACGCGGCGCTTCACGGTGCCGCTGTGGGTGT
GCGTCGCGCTCGCGCTGCTCGTGGGCTTCGGCGTGTTCGCGGGGCTGCGCATCGCGCTCGCCGGCCATTC
GGATCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAGCCGGCGCCGCCCGCGCCGCAT
CCGGCGCCCGCGCCGCGCGTCGCGAAGTTCCTCGAGCCGGAGATCGCCGCGGGGCTCGTGAGCGTGCGCG
ACGAGGCCGACCGCAGCGTGATCGTGCTGCGCGGCGACGGCCTGTTCGGCTCCGGCTCGACGTCGGTGAT
CGATCGCTACATGCCGGTGCTCACGCGCGTGGCCGACGCGCTGAACCGGGTGCAGGGCAACGTGCGCGTG
AGCGGCTACACCGACGACACGCCGGTGCACACCGCGCGCTTCGCATCGAACTGGGATTTGTCGCGCGAGC
GCGCGCAGGCGGTCCGCAGCCTGATCGCCGCGCGGCTCGACCGCCCCGAGCGGATCACCGCCGAAGGGCG
CGGCACGCTCGATCCGGTCGCGCCGAACGATTCGCCCGCGAACCGCGCGCGCAACCGGCGCGTCGAGATC
ACGCTGATGCTCGCGCCCGGCAGCGACGCCGCGCGCGCGACGAAGGAGGCGCCCTGA