SecReT6
Protein ID: 76817500
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1208
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1519198..1519773 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDQ3JJ88
KEGG IDbpm:BURPS1710b_A1208
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-38, Aligned region: 33..179
Protein Sequence: 191 a.a.     [Download]
>gi|76817500|ref|YP_336365.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MSLREAGGHFIAMQGKRPKMRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSP
IVLKVFQLKTASAFESADFFSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVL
EKNRWRMTVPLPRAKQLNLYRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 576 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1519773-1519198 Burkholderia pseudomallei 1710b chromosome II, complete sequence
TTGTCGCTGCGGGAAGCCGGCGGGCATTTTATTGCGATGCAAGGAAAGAGACCGAAAATGCGACCGCGGT
TCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTTGCCGGATGCGGGGCGACCGAGCGTTCCGTTGC
GGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCGCAAGCCGTCGCCG
ATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTCTTCTCGCTGCAGG
ACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGCGCCCGGGGGATGC
GCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGAATATCGCGTGCTC
GAGAAGAACCGCTGGCGGATGACGGTGCCCCTGCCGCGCGCGAAGCAACTGAACCTGTACCGATTCTGGC
AAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCCTCGGCGGCGATTC
GCGAGTACGCCAATGA