SecReT6
Protein ID: 76817580
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0534
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]720164..722446 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ3JL61
KEGG IDbpm:BURPS1710b_A0534
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.30E-187, Aligned region: 333..758
Protein Sequence: 760 a.a.     [Download]
>gi|76817580|ref|YP_335692.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MHRSQRSANTKPSLFRTSIDLSDAPHGSFHPQRRRHAATKNWNPAANAGSVFPSILAAPMRLLSVSCKTP
RASAHDRRPRATTKRRTQHDNERIRRAQRAGQHRLSPGDGRRTGGGRAAAQGARARRVLDGRRQAAARGA
LARERRQGRLQRRDEGAEPPARAQRAEPAGRSGRRGRPAVRHARLRFGARFLARRDRRESARAQAADRAA
RRAESAEEPDRQHSRLSQAHPGDRRRQGRAQAVARRTRPRRTMNRDTEQTTMEGEHLQSPKHDDAPDATP
PESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQATIDDMIAEIDRKLCRQIDA
ILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPDITKSGLYQKVYTAEYGQFG
GQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSFGKLPNVKDLASLFEGPQYA
KWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFLWGNAAFAFATRLTASFADY
RWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQGFIALTMRKNSDNAAFFSAN
STQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSWKERGDLEQELNQWIRQYVV
DMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTLSLVGKLEKR
 
Nucleotide Sequence: 2283 bp     [Download]
>gi|76817237|ref|NC_007435.1|:720164-722446 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGCATAGGTCTCAGAGGTCGGCGAATACTAAACCGTCTTTGTTTCGGACATCAATCGATCTTAGCGATG
CGCCGCACGGTTCTTTTCATCCGCAACGAAGGCGGCACGCGGCGACCAAAAATTGGAACCCGGCGGCTAA
CGCCGGTTCCGTCTTTCCTTCGATACTTGCCGCGCCGATGCGGCTTTTGAGCGTTTCGTGCAAAACGCCG
CGCGCATCCGCGCACGACCGTCGCCCGCGAGCGACAACGAAGAGGAGAACCCAACATGACAACGAACGGA
TCCGTCGCGCCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACGCACAGGCGGAGGTCG
AGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCCGCCGCTCGAGGAGCT
CTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAACCTCCAGCTCGCGCTC
AGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCACGCTCGGCTTCGATT
CGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCAGCTGATCGCGCTGCG
CGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGGCGCATCCAGGAGATC
GTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAACAATGAACCGCGACAC
GGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGCCGGACGCGACGCCG
CCCGAGTCCCCCGCCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCGCGACGAAGACGCAT
ACCCGATCACGCGCCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAGCGCCCGATCGAGAC
CGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCCGGCAGATCGACGCG
ATCCTCCATGACCCGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTTTCTCGTCGATCGAA
CGGATTTCCGCGAGAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTGTTCGACGACTTCGA
GGATTCGCCCGACATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGTACGGCCAATTCGGC
GGCCAGCCGATCGGCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGACGTCAAGCTGCTGC
AGTACGTCGCGAGCACGTCGGCGATGGCGCACACGCCGTTCATCGCGGCGGCGGGCCCCGCGTTCTTCGG
CATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGGGGCCGCAATACGCG
AAATGGAATGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCTTGCTGC
GGCTGCCTTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGCGTCGACGGCGGCGA
CGCGCATTTTCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGAGCTTCGCCGACTAT
CGCTGGTGCGCGAACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCCGCTCTACGCGTACG
AATCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGCCGCGAGTTCGAGCT
CGCCGAACAGGGCTTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCTTTTTCTCCGCGAAC
TCCACGCAGAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCTCAACTATCGGCTCA
GCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTGATCCAGCGGGAAAA
CATCGGCTCGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCCGCCAGTACGTCGTC
GACATGGACAACCCGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCAGATCGTCGTGTCGG
ACGTCGAGGGCGAACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTCAAGTACATGGGCGC
GTTCTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTAG