SecReT6
Protein ID: 76817764
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1201
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1507929..1509008 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ3JJ95
KEGG IDbpm:BURPS1710b_A1201
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 56..116
Protein Sequence: 359 a.a.     [Download]
>gi|76817764|ref|YP_336358.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MQSSDPIESLLAGVAPDAPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWSAVERLALELTAR
TKDLRVAAHLARSWTELRGMPGYADGLRLVAGMLDRWWDDVHPRLDADGDHDPAPRANALAEIAGAHDCA
RAARRQALFDGGPSVRDAERVFDGRDGGEHGYPGGRERLIADLVRARDGGQPTLQAAFAALDALDAIRAR
VASALGGEWVPDASDFEKALRRIVRDGLPPPAAGPAATNGAANVANAAHGGAANGVTNSAANGAASGGAP
AFAANGRAWRDAELTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESLPKL
DLLSGQRNE
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1509008-1507929 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCAGAGTTCAGACCCGATCGAATCGTTGCTCGCCGGCGTCGCGCCCGACGCGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAGAGCGCGACGCCGCGGCCCGAACAGCAGTACGGCGA
CACCGTGATCCCGGCCGAAGCGCCGGACTGGAGCGCGGTCGAGCGTCTCGCGCTCGAGCTGACGGCGCGC
ACGAAGGATCTGCGCGTGGCCGCGCATCTCGCGCGCAGTTGGACCGAACTGCGCGGCATGCCCGGCTACG
CGGACGGGCTGAGGCTCGTCGCGGGGATGCTGGACCGGTGGTGGGACGACGTGCATCCGCGCCTGGACGC
CGACGGCGACCACGATCCGGCCCCGCGCGCGAACGCGCTGGCGGAAATCGCGGGCGCGCACGACTGCGCG
CGCGCCGCGCGCCGGCAGGCGCTCTTCGATGGCGGCCCGAGCGTGCGCGATGCCGAGCGCGTGTTCGATG
GCCGCGACGGCGGCGAGCACGGCTACCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTTCGCGCGCG
CGACGGCGGGCAGCCGACGCTGCAGGCGGCATTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGCGC
GTCGCATCGGCGCTCGGCGGCGAATGGGTGCCCGACGCGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGTTGCCGCCGCCCGCGGCCGGGCCCGCCGCGACAAACGGTGCGGCGAATGTGGCGAATGC
GGCGCACGGCGGCGCGGCAAACGGCGTCACGAACAGTGCCGCGAACGGCGCGGCTTCGGGCGGCGCGCCG
GCTTTCGCCGCGAACGGCCGCGCGTGGCGCGATGCGGAGCTGACGAGCCGCGACGACGTTCAGCTCGGCC
TCGAAAAAATGTGCCGCTACTTCGAGCTGCACGAGCCGAGCCATCCGGCGCCGATCCTGCTGCGCCGCGC
GCAGCGGCTGCTGTCGCTCGACTTCTACGAAATCATCCGGGATCTCGCGCCGGAGAGCCTGCCGAAGCTC
GACTTGCTGAGCGGCCAGCGCAACGAATGA