SecReT6
Protein ID: 76817766
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1193
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1496460..1498655 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ3JJA3
KEGG IDbpm:BURPS1710b_A1193
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 20..322
Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 575..638
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 361..453
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 507..522
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 513..536
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 527..544
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 553..576
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 643..661
Gp5_C [PF06715], Evalue: 1.20E-08, Aligned region: 712..724
Protein Sequence: 731 a.a.     [Download]
>gi|76817766|ref|YP_336350.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGIVAR
AALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDYCVQ
YNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDSWLP
AQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHER
ALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLPYRS
PRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGVQIP
RIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKGAEQ
LWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETHGVA
GNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEI
GSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTVESS
ASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2196 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1498655-1496460 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGGAAGCGCTCG
GGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGAACTGCTCGG
CAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATCGTCGCGCGC
GCCGCGCTGGTCGGGCGGCGCGCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGTGGCTGTGGC
TCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAAATCGTGCAGGACGTGCT
CGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTACTGCGTGCAG
TACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACTACTTCAAGC
ACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCCGGGCTACGA
GCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGCTGGCTGCCC
GCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCGCGGATCTGT
CCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCCCGGCGGCTA
TCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAGCACGAACGC
GCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACTGCCCGCGCG
CCGACCAGAACCGCGAATACCTGATCGTGCGTTGCCAGTATCGGTTTCAGGAGAACGCGTACGCGACCGA
TAGCGGCAACGAGGCGGTCGTGCACGAATCTCAGACACTCGTGCAGCCTTCGAGCCTGCCGTATCGCTCG
CCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGAAGGGCGAGG
AAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCAGAGCGACCA
GAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTGCAGATCCCG
CGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGACGGGGCGCG
TGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACACAAAGCGGGCTGCTGTCGCG
CTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGCGCGGAGCAG
CTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACTGAGCAGGACCACACGCTGTCGGTGGGCCACG
ATCATTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAGCGTCGGGCA
GAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCATGGCGTCGCG
GGAAACCGCACGCGGCAGGTCGGACAGAACGAAGCCGTGACGATCGGCGCGAATCGCGAGGCGACGATCG
GCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATTGGGCAGGGCAAGACGCTGAATGT
CACTCAGCACTATCAGACGACTTCGAAGAGCATGAAGACCGCTGTCGCCGAACATCACGCCGAGGAGATC
GGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGGTGAACGTTG
GCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTCGCTCGTTTG
CGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATCGCGATCAACGGCGTCACGGTGGAATCGAGC
GCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACACGGTGGAAG
GCACGATACTGAAACTGAACCCCTGA