SecReT6
Protein ID: 76817808
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0537
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]723168..723629 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ3JL57
KEGG IDbpm:BURPS1710b_A0537
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.70E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|76817808|ref|YP_335696.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MADRESSRAGEPRTRERRLLERIANRAAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|76817237|ref|NC_007435.1|:723168-723629 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGCTGATCGCGAATCGTCGCGGGCCGGCGAGCCGCGCACGCGCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGCGCGGCGGGCGGCGAGCACGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACCTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA