SecReT6
Protein ID: 76817810
SecReT6 ID92
T6SS typei1
Gene symbolvirG
Locus tagBURPS1710b_A0531
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]717606..718343 [-]
ProductDNA-binding response regulator
NoteVirG
UniProt IDQ3JL63
KEGG IDbpm:BURPS1710b_A0531
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 1.50E-20, Aligned region: 10..117
Trans_reg_C [PF00486], Evalue: 9.70E-20, Aligned region: 161..235
Protein Sequence: 245 a.a.     [Download]
>gi|76817810|ref|YP_335690.1| virG gene product [Burkholderia pseudomallei 1710b]
MTNATRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVL
LRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRA
YRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWR
LRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG
 
Nucleotide Sequence: 738 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c718343-717606 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACGAATGCGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTT
GCAATTACCTGTCGGGCCACGGGATGGCCGTGGACGGGGTGGGAACGGCGGCAGCGGCCGCCGAATCGGT
CGGACGGCGCGAATACGAGATGGTGCTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGACGTGCTG
CTGCGCTGGCGCGAAACGCAGCGCTTTCCGCTCATCTGTGTGACGGGGCGCAGCGAAGAGGCCGATCGCA
TCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAAGCCGTACTCGCTGCGCGAGGTGCTCGCCCG
GATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGCGCGGCAGGCATCCGCGTGCG
TACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCGCAGGAAATTC
CGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGG
CTGCGCAAGAAAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACT
ACTTCGACGCGAAAGAGGTGGAGACGCTATGGGGATGA