SecReT6
Protein ID: 76817875
SecReT6 ID94
T6SS typei3
Gene symbolsciE
Locus tagBURPS1710b_A1623
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1980326..1981180 [-]
ProductSciE protein
NoteTagJ
UniProt IDQ3JI23
KEGG IDbpm:BURPS1710b_A1623
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.50E-44, Aligned region: 155..275
Protein Sequence: 284 a.a.     [Download]
>gi|76817875|ref|YP_336780.1| sciE gene product [Burkholderia pseudomallei 1710b]
MTNRSESPQPSDPRDAMLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQT
WAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAA
FHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALM
LDATVLRGYAPTRYSGSENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESD
DAAS
 
Nucleotide Sequence: 855 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1981180-1980326 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACGAATCGATCTGAATCTCCGCAACCCTCCGATCCGCGTGACGCCATGCTGCGCGACGCGCTGCGCG
CCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAAAGCGGCCATCCGACACGCGGGA
ACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCGCGCGCTCAAACAGCTGCAAACC
TGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGCGGCCTGATCCGATGCGAAATGT
TCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACGCGCAGCCCGCCTGGGTCGACAC
GCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGCGGACACGCTGCGCGAGGCCGCG
TTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGCTTCGCATGGCTTACCGACAGCG
ACACCCGCCTCGGTCCGATCTTCGAAATAGCGGTTGCAGGCGGCTATCGATGGATTCCGTTCGAACAACT
GAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTGGCGACCGGTCACGGCACTCATG
CTCGATGCCACGGTTCTCCGCGGCTATGCGCCCACCCGCTATTCGGGATCGGAGAACGGCGCGACCGCGA
TCCGCTTGGCCAGCGAGACGACCTGGCGCGACATCGGCACCACCAATGTCGTGGCGCTCGGACAACGAAC
ATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATGCCGCTTCACGGGCGAAAGCGAC
GATGCGGCATCCTGA