SecReT6
Protein ID: 76817929
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0545
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]737140..739740 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ3JL49
KEGG IDbpm:BURPS1710b_A0545
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-97, Aligned region: 304..325
DUF876 [PF05936], Evalue: 1.20E-97, Aligned region: 417..863
Protein Sequence: 866 a.a.     [Download]
>gi|76817929|ref|YP_335704.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MPEPRRRLQDPHAGRPRARPVSEHRPADDGRVDHDEGARLRHARAHEEIDDPDDERRSAGQRRRRDVGED
HGQGRIHRGQRESEVRRRRGRAADDADEAQRRQRDGRRAAAEPAESDGDELRRGHERTTHCPAGRDARAP
ADAARPAVMAVANVSRMRGSHMRCRARRARRPRRLCGPRHRRAGARRRAMGLRARRAAHRYRRVGAVERI
PERAAHAVARGVPERGREGVPPARRRSGPAAHDARGGRPRRGLHSDDPLRRRARPACRAVDRSRAAGALR
RHRRRLLRRRRPTRGAPVRGAAAHRQARLVLLHLSRRAANARAEAQARRAEHHRRARSAAEPAAAGRARM
DGARQRREDPGAAERRRERRRQRQARQTRQRRRPCAAQAMTHDASRTGTNDMDNVYWHQGMLLQPQHFQL
AELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIRSARLLFADRSYVEYPGNAVVAARAFDPAW
LDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRYATLPSAEEVADLHSDHPGAPVRTLKHVLKIV
FEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRCIRDELAGRARQLQQYKNPR
EMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVGELSVFSERFDMLGETPDAR
GGLPPYDHRDLGGCFSRAHALIGHLLDAIAVGPDCVATFEPDGPQQPAQRSAQLPPDVFADRHQIYLAIR
SAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRGDARYFRIEQAGRPWDAIRR
DGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|76817237|ref|NC_007435.1|:737140-739740 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGCCTGAGCCCCGCCGACGTCTGCAAGACCCCCACGCCGGGCGGCCCCGTGCCCGTCCCGTATCCGAAC
ACCGGCCTGCCGATGATGGCCGCGTCGATCACGACGAAGGTGCTCGTCTGCGGCATGCCCGCGCTCACGA
AGAAATCGACGATCCCGATGACGAACGGCGATCAGCCGGGCAGCGCCGGCGGCGTGATGTCGGCGAAGAT
CATGGGCAAGGTCGAATTCACCGCGGGCAGCGCGAAAGTGAAGTTCGAAGGCGGCGCGGCCGTGCGGCTG
ACGACGCCGACGAAGCACAACGAAGGCAACGCGACGGGCGCCGTGCTGCAGCCGAGCCAGCAGAAAGTGA
TGGTGATGAGCTGAGGCGCGGACATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCG
GCCGATGCAGCCCGGCCGGCCGTCATGGCCGTCGCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCT
GCCGTGCTCGTCGCGCTCGCCGCCCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCG
ACGTGCGATGGGACTACGCGCCCGACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATA
CCTGAACGCGCCGCACACGCTGTTGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTC
GCCGACGATCCGGACCGGCTGCGCATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGA
CCCGCTACGTCGTCGCGCCCGGCCAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGT
CGGCATCGTCGCCGGCTACTACGACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGC
ATCGACAAGCGCGGCTGGTTCTCCTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGC
TCGGCGCGCAGAGCATCACCGACGCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATG
GACGGCGCTCGACAGCGGCGCGAAGACCCTGGCGCTGCCGAGCGCCGACGCGAACGACGGCGGCAGCGGC
AAGCGCGACAAACGCGGCAACGCCGCCGCCCGTGCGCCGCGCAAGCAATGACGCACGACGCATCACGAAC
CGGAACGAACGACATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTG
GCCGAACTGCACCAGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGGCCCACCGCATTTCTGGGGCGTCG
GCGCGCTGTCGCTCGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAGATCCGCTCGGCGCGCCTGCTGTT
CGCCGATCGCAGCTACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGG
CTCGACGAAGGCCGCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGA
CGGTCGCGGCCGCGCCCGACGCGCTGCCCGACGCCCCGACGCGCTACGCGACGCTGCCGTCCGCCGAGGA
GGTCGCCGATCTGCATTCGGACCATCCGGGCGCGCCGGTGCGCACGCTCAAGCACGTGCTGAAGATCGTG
TTCGAGCACGAGCTCGACGCGCTCGCCGCGCACGAAACGATCCCGATCGCGCGGATCGTGCGCGACGGCG
AGCGCCTGCGGCTCGACGACGATTTCGCGCCGCCCTGCTACGCGCTGTCGGGCTCGCGCACGCTGCTCGA
GCGCGTGCGCTGCATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGC
GAGATGCAACGCGCCGAATTCGACGCGAGCTATGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCT
TCGGCCCGCTGCTGTTCCATCTCGCCGAATGCGACGGGCAGCATCCATGGACGGTCTACGGCGTGCTGCG
CCAACTCGTCGGCGAGCTGAGCGTGTTCTCCGAGCGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGC
GGCGGCCTGCCGCCGTACGACCACCGCGATCTGGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCC
ACCTGCTCGACGCAATCGCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCCCGCAGCAGCC
CGCGCAACGCTCGGCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCAGATCTATCTCGCGATCCGC
AGCGCGCACGATCCGGACACGCTCGCGCAACGCTTCGCGCTCGGCGGCCGGATCGCGGCGACCGACGAAA
TGCCGCAGCTCACCGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGCCTGCCCGGCCCGCCGCCGCGGCT
GCCGCGCCGCGGCGACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGCCCGTGGGACGCGATCCGGCGT
GACGGCCGCGTGTCGCTGCGCTGGGCCGACGCGCCGGACGACCTGCACGCGGAACTCGTCGCGGTGAGGC
ACACGCAATGA