SecReT6
Protein ID: 76817970
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1695
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2069429..2073145 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ3JHV1
KEGG IDbpm:BURPS1710b_A1695
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-57, Aligned region: 1056..1209
Protein Sequence: 1238 a.a.     [Download]
>gi|76817970|ref|YP_336852.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTIRPPPQNNLINENQFNETGRAQSNESDFPDRRAGKLIDALWVFGITITPIRKGPVHGDLASGAVRETR
GYALQGDRIGHGFLQAARQSVRRAGALAAAVVAAVRLRSAPDRAARRHRARRARSRHRARARRAAGRRGL
DQRFFPSRRNRDRARMGARDAALRRPAHPRRMARRRARRYAGTAARAAFHFAGVREDSSRRRSRRRAARV
DGRFAGSGGRAVRPRRFRARFAGRAVRRDARRAERLAARAILHGPDRARSRRRHRPRHRARARNPHDDRR
ATAAQAEQSAAHRRGGRGQDGRRRGPRARDRERRRAAEAGRRAPDERRRGRAAGRRGHERRIRIAPERRA
RGRGEIRRARHPVRRRDSHADRRGRTGRHGRRGEPAQARARARHDPHDRRDDMGGVQAAHRKGSRIDPPL
SGAASAGARRAGRGAHGAGRRASVRAAPPRDGARRGDPRRRRAVAPLHSVAASAGQGDQPPRHRMRARRA
LAARRARRTAARAPALARGARRARSARTGGAHRARRRAIARGGARTHRSARGRGSGRRRALEGAGRRGAR
AARRARGRARGMSPRVLRRNARRLALRISYRISYRIARQITHRLQRLCSQRRPGRNARRFAHRNASGHAR
RSARRPRLAPARRRYAARRRRPRAARARTRARGGPGRRTARVPGSRRGDRRADRRGLDRHSGRPHDDRRS
RRRARAARDARGARDRPARRAAADRRARADRARGPRRSEEAARRIPACGPVGRRQDRNGARARRGAVRRR
TEPDHDQHERVPGSPHRVGPQGRAARLCRLRRGRRADRGGAAAAVQRRAARRDREGAPRRARTLLPGLRQ
GLHGRRRRPLHRFPQHDDPAHEQRRRGTEREPVCRRIARARCRRAARRAHARTAEGLPRRVPRARERRAV
PAARSARARAHRAPASGSRRRAHGRAAPHRARVRRRRRRLRRRALPRAGNRRAAADRIHRAARAASAVRA
VARRVPVEGGARAHRHRCGRRGRARGARARLPARPSKPGGAAERAAHRRAGRLALLSFPSLTESRMSASS
SSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNFDERMK
AIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKSGAETL
VNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAKDAPDTANHDSDAA
 
Nucleotide Sequence: 3717 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2073145-2069429 Burkholderia pseudomallei 1710b chromosome II, complete sequence
TTGACCATCCGCCCGCCGCCTCAAAATAATTTAATTAACGAAAATCAATTCAACGAGACCGGACGAGCGC
AATCGAACGAATCGGATTTCCCCGATCGTCGCGCCGGCAAATTGATCGATGCGCTGTGGGTTTTCGGGAT
AACGATCACACCGATCAGGAAAGGACCTGTCCATGGCGATCTCGCGTCAGGCGCTGTTCGGGAAACTCGG
GGCTACGCTCTTCAGGGCGATCGAATCGGCCACGGTTTTCTGCAAGCTGCGCGGCAATCCGTACGTCGAG
CTGGTGCACTGGCTGCAGCAGTTGTTGCAGCAGTCCGACTCCGATCTGCACCGGATCGTGCGGCACGCCG
GCATCGAGCGCGACGCGCTCGATCGCGACATCGCGCGCGCGCTCGCCGCGCTGCCGGCCGGCGCGGGCTC
GATCAGCGATTTTTCCCATCACGTCGAAACCGCGATCGAGCGCGCATGGGTGCTCGCGACGCTGCGCTTC
GGCGACCGGCGCATCCGCGGCGCATGGCTCGTCGCCGCGCTCGTCGATACGCCGGAACTGCGGCGCGTGC
TGCTTTCCATTTCGCCGGCGTTCGCGAGGATTCCTCACGACGACGCTCTCGACGACGTGCTGCCCGCGTG
GACGGCCGGTTCGCCGGAAGCGGCGGACGCGCCGTACGACCACGCCGATTCCGCGCCCGCTTCGCCGGGC
GAGCCGTCCGGCGCGACGCGCGCCGCGCCGAACGGCTCGCCGCTCGAGCGATATTGCACGGACCTGACCG
CGCGCGCTCGCGACGGCGACATCGACCCCGTCATCGGGCGCGAGCTCGAAATCCGCACGATGACCGACGT
GCTACTGCGGCGCAGGCAGAACAATCCGCTGCTCACCGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTC
GAGGGCCTCGCGCTCGCGATCGCGAACGGCGACGTGCCGCCGAAGCTGGCCGACGTGCGCCTGATGAGCG
TCGACGTGGGCGCGCTGCTGGCCGGCGCGGGCATGAAAGGCGAATTCGAATCGCGCCTGAAAGGCGTGCT
CGAGGCCGCGGCGAAATCCGTCGCGCCCGTCATCCTGTTCGTCGACGAGATTCACACGCTGATCGGCGCG
GGCGGACAGGCCGGCACGGGCGACGCGGCGAACCTGCTCAAGCCCGCGCTCGCGCGCGGCACGATCCGCA
CGATCGGCGCGACGACATGGGCGGAGTACAAGCGGCACATCGAAAAGGATCCCGCATTGACCCGCCGCTT
TCAGGTGCTGCAAGTGCCGGAGCCCGAAGAGCCGGCCGCGGTGCACATGGTGCGGGGCGTCGCGCGAGCG
TTCGCGCGGCACCACCGCGTGACGGTGCGCGACGAGGCGATCCGCGCCGCCGTCGCGCTGTCGCACCGCT
ACATTCCGTCGCGGCATCTGCCGGACAAGGCGATCAGCCTCCTCGACACCGCATGCGCGCGCGTCGCGCT
CTCGCAGCACGCCGCGCCCGGCGAACTGCAGCACGTGCGCCAGCGCTTGCTCGCGGCGCGCGCCGAGCGC
GATCTGCTCGAACAGGAGGCGCGCATCGGGCTCGACGCCGGGCAATCGCTCGCGGCGGTGCGCGAACGCA
TCGAAGCGCTCGCGGCCGAGGAAGCGGCCGTCGACGCGCGCTGGAAGGCGCAGGCCGACGCGGCGCGCGC
GCTGCTCGCCGCGCGCGAGGCCGCGCTCGCGGAATGTCACCGCGAGTCTTGCGCCGAAACGCGCGCCGGC
TCGCTCTCCGAATCTCGTACCGAATCTCGTACCGAATCGCGCGCCAGATCACACATCGACTCCAGCGCCT
GTGCTCACAGCGACGTCCCGGCCGAAATGCACGCCGGTTCGCGCACCGCAACGCGTCCGGACACGCACGC
CGAAGCGCACGCCGCCCCCGCCTCGCCCCCGCCCGCCGCCGATACGCCGCACGCAGGCGCCGCCCCCGGG
CTGCGCGAGCTCGAACGCGCGCTCGCGGCGGCCCAGGGCGACGCACCGCTCGTGTTCCCGGAAGTCGACG
AGGCGATCGTCGCGCAGATCGTCGCGGATTGGACCGGCATTCCGGTCGGCCGCATGATGACCGACGAAGT
CGCCGCCGTGCGCGCGCTGCCCGCGACGCTCGAGGCGCGCGTGATCGGCCAGCCCGACGCGCTGCGGCAG
ATCGGCGAGCGCGTGCAGACCGCGCGCGCGGGCCTCGCCGATCCGAAGAAGCCGCTCGGCGTATTCCTGC
TTGCGGGCCCGTCGGGCGTCGGCAAGACCGAAACGGCGCTCGCGCTCGCCGAGGCGCTGTACGGCGGCGA
ACAGAGCCTGATCACGATCAACATGAGCGAGTACCAGGAAGCCCACACCGTGTCGGGCCTCAAGGGCGCG
CCGCCCGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGCG
TCGTGCTGCTCGACGAGATCGAGAAGGCGCACCGCGACGTGCACGAACTCTTCTTCCAGGTCTTCGACAA
GGGCTACATGGAAGACGGCGACGGCCGCTACATCGATTTCCGCAACACGACGATCCTGCTCACGAGCAAC
GTCGGCGCGGAACTGAGCGCGAGCCTGTGTGCCGACGCATCGCTCGCGCCCGATGCCGCCGCGCTGCGCG
ACGCGCTCATGCCCGAACTGCTGAAGGTCTTCCCCGCCGCGTTCCTCGGGCGCGTGAGCGTCGTGCCGTA
CCGGCCGCTCGAAGCGCGCGCGCTCGCGCGCATCGTGCGCCTGCATCTGGATCGCGTCGTCGCGCGCATG
GCCGAGCGGCACCGCATCGCGCTCGCGTACGACGACGCCGTCGTCGACTACGTCGTCGGGCGTTGCCTCG
TGCAGGAAACCGGCGCGCGGCTGCTGATCGGATTCATCGAGCAGCACGTGCTGCCTCGGCTGTCCGCGCT
GTGGCTCGACGCGTTCCCGTCGAAGGCGGCGCTCGCGCGCATCGACATCGGTGTGGCCGACGCGGCCGCG
CCCGCGGCGCGCGCGCTCGTCTTCCGGCCCGGCCAAGCAAGCCGGGCGGGGCCGCCGAACGCGCCGCTCA
CCGCCGTGCAGGCCGGCTAGCCCTGCTGTCTTTCCCTTCACTCACGGAGTCCCGCATGTCCGCATCCAGC
AGCTCTCAAAAATTCATCGCGCGCAACCGCGCGCCCCGCGTGCAGATCGAATACGACGTCGAAGTCTACG
GCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTCGGGCAAGCCGGTCGC
GCCGCTGCCCGCCGTCGCCGACCGGCGCTTCCTCGACATCGACATCGACAACTTCGACGAGCGGATGAAG
GCGATCAAGCCGCGCGTGGCGTTCGCGGTGGACAACACGCTGTCGGGCGACGGGCAGCTGATGGTCGACA
TGACGTTCGAAAGCATCGAGGACTTCTCGCCCGCCGCGATCGCGCGAATGGTCGGCCCGTTGCGGCAATT
GCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGGCAAGTCGGGCGCCGAGACGCTC
GTCAACCAGTTGCTGCAGGACCCGGCGCTGCTGCGCTCGCTCGCAGCCGCGCCGAAGCCGCAGCTCGCGG
GCGGGCCGGACGCGGGCAATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAACCACGACAGCGATGC
GGCCTGA