SecReT6
Protein ID: 76817987
SecReT6 ID96
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A2075
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2523594..2525099 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ3JGS7
KEGG IDbpm:BURPS1710b_A2075
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|76817987|ref|YP_337226.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIEQL
VAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVWDQ
SPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWSEL
SNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFCWA
NSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSESGL
MPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSAED
TQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRLVS
KLPSTKHEVTT
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2523594-2525099 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATCTGAAGG
ACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAAGCGGTGCAGAACGCGGTCGAGAC
GCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAGCAGCTG
GTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTCAGAGCC
TCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAAGATCCG
CTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGGGATCAG
AGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGA
TCGGCGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGATCTCGGC
GGCCGCTCACGCGCCGTTCATCGCGGCCGCCGCGCCAGGCCTGCTGCAGATGGACGACTGGAGCGAGCTG
TCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAATATGCGTTCTGGCGGCGCCTGCGCGAGA
GCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCCGAAGAC
GCAGCCCGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGATCCGAACCGCGCGGAGGATTTCTGCTGGGCG
AACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGAAGATTC
GCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCGCGAAGT
CGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCGGGCCTG
ATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATCGTCCGG
CGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTTCGCGAC
CTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCCGAGGAC
ACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCGAGGTGA
CGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGGCTACTA
TCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTGGTTTCG
AAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA