SecReT6
Protein ID: 76818050
SecReT6 ID96
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A2079
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2528154..2529143 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ3JGS3
KEGG IDbpm:BURPS1710b_A2079
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-58, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|76818050|ref|YP_337230.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTPLERVSRALTPRRTFFELMRRVEALQRRHDGRSARKRRMPKWLRIEQPAQMHFASTEVERVQVTLARF
VEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVACGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADACRAQQDDGEPYGRHALACRRAFPGIYCAPRRSLADLQRLLRAYFGVALQV
VPRHGRWVPVPAAASHARRLGGWRLGARIWDVQHSIEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2528154-2529143 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACGCCGCTCGAGCGCGTGAGCCGGGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGCG
TCGAGGCGCTGCAGCGCAGGCACGACGGGCGTTCGGCGCGCAAGCGCCGGATGCCGAAGTGGCTGCGCAT
CGAGCAGCCGGCGCAGATGCACTTCGCGAGCACGGAAGTCGAGCGCGTGCAGGTGACGCTCGCGCGCTTC
GTCGAGGACGACGATCACCCGCAAGTCACGGTGGCGCAGCGCCATTTCGGGCTGTTCGCGCCGTACGGGC
CGCTGCCGCTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCCGCGTTCGAGCG
CTTCGTAAACGTCGCGTGCGGCGATCTCGCGTGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGCGCGCGCAATCCGTTCGTCGAGCGCGTGACGGCGCTCGCCGATGCGTGCCGCGCGC
AGCAGGACGACGGCGAGCCGTACGGGCGGCACGCGCTCGCATGCCGGCGCGCGTTTCCGGGCATCTACTG
CGCGCCGCGCCGCTCGCTGGCCGATCTGCAGCGGCTGCTGCGCGCGTACTTCGGCGTGGCGCTGCAGGTC
GTGCCGCGCCACGGGCGCTGGGTGCCGGTGCCGGCCGCGGCGAGCCATGCGCGGCGGCTCGGCGGCTGGC
GGCTGGGTGCGCGGATCTGGGACGTGCAGCACTCGATCGAGATCGTGGTGGGGCCGATCGAGGCGGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCCGCCGTGATGGCGCTGTCGGCGGTCGTGACGGATTTCGTCGAC
GGACGGATTTACCCCGTCATCAAGGTTCAGGTGTGGACGCGCCCTGAACTCGCAGGAAGGGTTGGGTGCA
TGCGTGTCGGGGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCTTGACTGTCTTTGAATCTTT
TCGGGACTAG