SecReT6
Protein ID: 76818079
SecReT6 ID94
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1621
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1977939..1979819 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ3JI25
KEGG IDbpm:BURPS1710b_A1621
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|76818079|ref|YP_336778.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPYVERLIEAFCFMSARTQLKLEAEFPR
FTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDFSKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWP
IEIAGATLTAVPPDLPDLQRSLLPHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFEL
IHASSVASVVRAPGAARGEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQ
LNAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQTAFHLIPDRTR
PLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRTTSTNARKYGTRTPYVGTEV
YVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPSAPREPYATGE
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVY
GRGVRCELTVDESGFSGLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1979819-1977939 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGACCCGCAGTTTCTCGATCACTACAACCGCGAATTGACCTACATGCGGGAGTTGTCCGCGGAATTCG
CGGCGCAACACCCGAAGATCGCGCGCCGACTCGGCATGCAAGGCATCGAAGTGGCGGACCCGTACGTAGA
ACGGCTCATCGAGGCGTTCTGCTTCATGTCCGCGCGCACGCAACTCAAGCTCGAGGCCGAGTTCCCCCGC
TTCACGCAACGCCTGCTCGAAGTCGCCTATCCGAATTACGTCGCGCCGACGCCGTCGATGGCCGTCGCGC
GCCTGCGTCCAAGCCTGCGGGAAGGCGACTTCAGCAAGGGGTTCAAGGTTCCGCGTCACAGCATGCTGCG
CTCGTCGATCCCGCCCGGCGAGCAGACCGCATGCGAATTCCGCACCGGCCAGGACATCACGCTCTGGCCC
ATCGAGATCGCCGGCGCGACGCTGACCGCCGTGCCGCCCGATCTTCCGGATCTTCAGCGCAGCCTGCTGC
CGCACACGAAGCTGCGCGGCGCACTCCGGCTGCGCGTGCGCACCGTCGGCGAAATCAGGTTTTCGCAAAT
TACCGGGCTCGATCGCCTCTCGCTGTATATCGGCGGCGACGAACGCATCGCCTCCCATCTTTTCGAGCTG
ATTCACGCGAGCAGCGTCGCGTCGGTCGTGCGCGCGCCGGGCGCCGCGCGCGGCGAAGGCGCCGTCGTCG
CGAAGAATGCGGTCGACTTCGAAGGCCTGTCGCCCGATCAAAGCCTGTTGCCGCTCGTCTGGAATACGTT
CCACGGGCACAATCTGCTGCACGAATACTTCACCTGCCGTCAGCGCTTCTATTTCTTCGCGCTCACGCAA
TTGAACGCCGGCTTGTCGCGCATCGACGGAAAGGAAGCCGAAATCGTGCTGTTGCTCGACCGCTTGCCCG
ACGAGCTCGTCACGCACGTCGAGGCCGCGCGCTTTCTGCTGTTTTGCGCCCCCATCGTCAATCTGTTCCC
GAAGCGGACCGACCGGGTGGAAATCAATCGCGCCCAAACGGCTTTCCACCTGATACCGGACCGCACCCGC
CCGCTCGATTACGAAGTATTCTCGGTGTCGCGCGTGTTCGGGCAAAAAGCCGAGACGTCGACGGAAGTCA
CGTTCAATCCGCTCTATCAGACGCTGCATAGCGACATCGGCAATTACGGCCGGTATTTCTCGATCCTGCG
CGAACCCAGAACGACATCGACCAACGCGCGTAAATATGGAACGCGCACGCCATACGTCGGAACGGAAGTC
TACGTGTCGCTCGTCGACCAGGCCGAAGCGCCGTACGCCGACGACATTCGTTACCTGTCCGTCGACGCAT
GGGTCACCAACCGCGATCTGCCCCGACTGATCCCGCGCAACGGCGTCAACGATCTGACGATGCAAGACTC
CGTGCCGATCGAGGGCGTGAGCCTCGTCCATCCGCCGAGCGCGCCGCGCGAGCCGTACGCGACCGGCGAA
ACCGCGTGGCGGCTGATTCGCCAGCTCAGCTTCAACTACATGCCGCTTGCCGAGCTCGACCACCGCGACG
GCGGGCAAGCACTGCGCAACATGCTGCGCCTCTTCGTCGGCACGAGCGAGCGCGAACAGGCCACGCAGAT
CGACAGCCTGGTCGGCGCGCGCACGGAGCCTGTCGTCCGCCGTCTGCCCGGCCACGGATTACTGGTTTAC
GGGCGCGGCGTCCGGTGCGAGCTGACCGTCGACGAAAGCGGCTTCTCCGGGTTGAGTCCATACCTGTTCG
GTCTCGTGCTCGAGCAATACCTCACGCGCCACGTCTCGATCAATGTGTTCACCGAGACGGAGCTTCGCTC
GATGCAACGCGGCCTCGTCACGCGCTGGAAACCGCGCATGGGCGGAAGGGGCGCGGTATGA