SecReT6
Protein ID: 76818111
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1698
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2074222..2075187 [+]
ProductImpE protein superfamily protein
NoteTagJ
UniProt IDQ3JHU8
KEGG IDbpm:BURPS1710b_A1698
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.80E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|76818111|ref|YP_336855.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFRARVMAGHARPGFVFDAPPWIDDLREALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFADLAGWRLARPGVPLDLVWAPCVLTLADGSV
AHGFMPARYPGSELADGSGAPGASAAAHEADAHESAVREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2074222-2075187 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACGACGCCCGCCTTCCCGGCGCCGCCCGGCGCGCGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGTGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCGCGCCCGCG
TGATGGCGGGCCACGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCGGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTGCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCCGCTCGATCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCGGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGAGCGGCGCGCCGGGCGCCT
CGGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGTGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA