SecReT6
Protein ID: 76818158
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1197
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1504657..1505217 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ3JJ99
KEGG IDbpm:BURPS1710b_A1197
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-22, Aligned region: 50..164
Protein Sequence: 186 a.a.     [Download]
>gi|76818158|ref|YP_336354.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGE
DGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAA
GERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 561 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1505217-1504657 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAATGACGACGTGCGAGCCGCGGGCGGCGGAGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGC
CGGCGCTGCTCGACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGAT
CGGCGGCGAGCGCCTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAG
GACGGCTTCGTCGACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGC
TCGTCGGCAAGCCGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCG
TTTCGAGCCGCGTATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCG
GGCGAGCGCCGGCACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCG
AGTTCGTGCTGCGCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTG
A