SecReT6
Protein ID: 76818282
SecReT6 ID96
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A2087
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2541253..2541792 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDQ3JGR5
KEGG IDbpm:BURPS1710b_A2087
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.60E-12, Aligned region: 1..136
Protein Sequence: 179 a.a.     [Download]
>gi|76818282|ref|YP_337238.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADWLPTQGGDDSSCASRGQDS
TVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEGRGLIHMAVWLDRDGIYNA
LLPGPVPVGGAIAPAAVRPDEPPPERKTKITYGTRRSRQ
 
Nucleotide Sequence: 540 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2541253-2541792 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGCTCGCCGGCTGCTCGGCCTTCTCGTCGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCG
TCGGCGGCGCCCGGCTGAACGTCGCGCCGACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGT
GACCGCGGCCGACTGGCTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGC
ACGGTCGTCGCCGACTCGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGC
GCTCGGGCGAGCTCTGGCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCG
CGTGCGCGTCGAGGGCCGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCG
TTGTTGCCGGGGCCCGTGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGC
CCGAGCGCAAGACGAAAATCACCTATGGGACAAGGAGAAGCAGGCAATGA